SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015125253.1.5248 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015125253.1.5248
Domain Number 1 Region: 14-325
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-56
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 428-545
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 7.19e-31
Family Pentapeptide repeats 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015125253.1.5248
Sequence length 554
Comment serine/threonine protein kinase [Synechococcus sp. PCC 6312]; AA=GCF_000316685.1; RF=na; TAX=195253; STAX=195253; NAME=Synechococcus sp. PCC 6312; strain=PCC 6312; AL=Complete Genome; RT=Major
Sequence
MSYCYNPACTNPANPDDAPLCQACGTNLLLHSRYRCTKILGRGGFGTTFLADDMVLPGKP
NCVIKQLRPAASAPHILEMARQLFQREATTLGKVGNHPQVPRLLDYFELEPEFYLVQEYV
SGLTLQQEVKRNGPMSEGQVRQVMLEVLPILDYLHKIEVIHRDIKPANLIRREIDGKLIL
IDFGAVKDQVSQAMMANPQDYTAFTAFAVGTPGYAPPEQMAMRPVYASNIYALGVTCIYL
LTSKSPKDLGYDNTTGEFIWRSRVNISNDLQNVLEKMTEVSIKHRYQTAQDVLQDLQLVQ
KRLDLQQFSSPSSADSDISQGLAAGPLHSRHQPNAKPTAGPQSTGSLPTTVSPTTRHAAN
AARSQQARAGLQPNYSRFTPPSVRPPNRVGGVGQGSLSQVSRENTLQSEGGRLSLQALVA
AYNRGERDFSESRLDNIVLRKANLSDARFVQAFLQKADLRGCVMMNVDFGRANLGGANLR
DCDLRASYFVNADLQGANLQGANLRETSMTNANLRGANLQNADLTGSNITPNQIAQARTN
WFTIHPNGKRGIGI
Download sequence
Identical sequences K9RUT9
gi|427713629|ref|YP_007062253.1| WP_015125253.1.5248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]