SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015125333.1.5248 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015125333.1.5248
Domain Number 1 Region: 116-243
Classification Level Classification E-value
Superfamily Cysteine proteinases 3.04e-27
Family NlpC/P60 0.00000923
Further Details:      
 
Domain Number 2 Region: 13-83
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 7.23e-16
Family Spr N-terminal domain-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015125333.1.5248
Sequence length 254
Comment cell wall-associated hydrolase [Synechococcus sp. PCC 6312]; AA=GCF_000316685.1; RF=na; TAX=195253; STAX=195253; NAME=Synechococcus sp. PCC 6312; strain=PCC 6312; AL=Complete Genome; RT=Major
Sequence
MVTWAELIGLPASQFYRITHPLNIYDSPALSSLATQAWAGRYLQLFNLPPEKPSYRTGYE
ILLWEDQYPGWLAGEDLAHLEPTPLLSPPKQLKRDEILQRIPAIIEFCHMAQTRCHTYLW
GGTLGPSYDCSGLIQASFATMGIWLPRDAYQQEGVVAPIPNPGVNPDDVVPYLESGDLVF
FGPPLKATHVSLYLGDGQYLHSSGKDQGRNGIGMDSLLLQDHPNPDPISQAYYQQFRGAG
RVMTSFSPNLEGID
Download sequence
Identical sequences K9RW79
WP_015125333.1.5248 gi|427713710|ref|YP_007062334.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]