SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015125773.1.5248 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015125773.1.5248
Domain Number 1 Region: 112-208
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.83e-38
Family Ribosomal protein S3 C-terminal domain 0.0000155
Further Details:      
 
Domain Number 2 Region: 2-108
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 2.88e-34
Family Prokaryotic type KH domain (KH-domain type II) 0.0000646
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015125773.1.5248
Sequence length 244
Comment 30S ribosomal protein S3 [Synechococcus sp. PCC 6312]; AA=GCF_000316685.1; RF=na; TAX=195253; STAX=195253; NAME=Synechococcus sp. PCC 6312; strain=PCC 6312; AL=Complete Genome; RT=Major
Sequence
MGQKINPIGFRLGITQDHRSRWYADASRYPELLQEDHRIRQYIEKTLAGASIADVRIERK
ADQVELQVRTARPGVVVGKGGAGIENLRLSLKKLLPPGRSVKVNVVEVTRVDAEAGLLAE
YITQQLERRVAFRRAVRQAIQRAQRAGVEGIKIQVAGRLNGAEIARTEWTREGRVPLHTL
RADIDYAYRTAKTIYGILGVKVWIFKGEVLPGQQPDPDFGREQPRQRPPRQRRNFEDRSS
RNES
Download sequence
Identical sequences K9RXN8
WP_015125773.1.5248 gi|427714152|ref|YP_007062776.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]