SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015127816.1.42896 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015127816.1.42896
Domain Number 1 Region: 1-251
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.17e-88
Family Tryptophan biosynthesis enzymes 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015127816.1.42896
Sequence length 278
Comment tryptophan synthase subunit alpha [Calothrix sp. PCC 7507]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence
MTAISDRFETLGRNHECALIPFITAGDPDLATTAAALRTLDRSGADIIELGVPYSDPLAD
GPVIQAAATRALQRGTTLDQVLEMLQATTPSLRSPIVLFTYYNPILHLGIEKFIQKIATS
GAAGLVVPDLPLEEAEGLLQASSEAGIDLTLFVAPTSSSERIEAIARSSQGFIYLITVTG
VTGIRSQTETRVSDLLKQIRDVTDKPIGVGFGISQVSQARQVRDWGADAVIVGSAFVKRL
AEGTPEQGLKAIAEFCQSLKAAIKTGDTSTNTYLDETK
Download sequence
Identical sequences K9PFR9
gi|427716838|ref|YP_007064832.1| WP_015127816.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]