SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015128581.1.42896 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015128581.1.42896
Domain Number 1 Region: 31-365
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.16e-48
Family Filamentous hemagglutinin FhaB, secretion domain 0.0065
Further Details:      
 
Domain Number 2 Region: 339-441
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000163
Family Filamentous hemagglutinin FhaB, secretion domain 0.044
Further Details:      
 
Weak hits

Sequence:  WP_015128581.1.42896
Domain Number - Region: 442-513
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000942
Family Filamentous hemagglutinin FhaB, secretion domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015128581.1.42896
Sequence length 600
Comment filamentous hemagglutinin family outer membrane protein [Calothrix sp. PCC 7507]; AA=GCF_000316575.1; RF=na; TAX=99598; STAX=99598; NAME=Calothrix sp. PCC 7507; strain=PCC 7507; AL=Complete Genome; RT=Major
Sequence
MSHNQSSWYYKLGLCSPLAIIGAIALSADCALAQIIRDNTLGSESSIITPQLINNQPINQ
IDGGATRNQNLFHSFEQFSVPTDSTAYFNNTANIQNIITRVTGKSISNINGAIRANGSAN
LFLLNPNGIIFSPNASLNIGGSFVASTASSLNFADGTKFSATNPQTTPLLTISVPIGLQF
GTSPGTIRNQSQASPGGATNSLIRPVGLQVNVGKTLAFVGGGLSLEGGNLTAKGGRIELG
SVAANSLVSLSAIDQGWSLGYKDVQDFQNIQIIDRNQIPSYVDVSGEGGGNINVQGKRLL
LTGGSMILANTLGAEPGGDLTVNTSESVELIGFPTSLRTRSFSSGNVGNLTVTTKKLIVR
DGAQIFVNSSSSGSTGQLTVNASDSVELIGGSKVQFPFPRFDVSGLLSATSGAGNASDIT
INTGRLIVQGGARVSTQSAGFITASRQVIPATGKGGNLTVNASKSVELIGDLAINQNSGL
FTSTQGPGNAGNLTLTTEKLIVRDGAKISLSSQSPQNSISRNLGKAGELDITARSVLLDN
ICNTYILRTGTAPINYRFSRKSMDAVPLPICRILFLNWYEKLLPLQRFVVFRSPTSYRHP
Download sequence
Identical sequences K9PJQ7
gi|427717607|ref|YP_007065601.1| WP_015128581.1.42896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]