SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015132396.1.56710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015132396.1.56710
Domain Number 1 Region: 12-412
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.51e-125
Family Cystathionine synthase-like 0.0000000000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015132396.1.56710
Sequence length 420
Comment cysteine desulfurase [Leptolyngbya sp. PCC 7376]; AA=GCF_000316605.1; RF=na; TAX=111781; STAX=111781; NAME=Leptolyngbya sp. PCC 7376; AL=Complete Genome; RT=Major
Sequence
MIVMPTKSLAAEVRDDFPILNQEVHGKPLIYFDNAATSQKPQAVLDALMHYYTSDNANVH
RGIHSLSSRATDAYEGARDKVAKFINATSRDEIVYTRNASEAINIVAYTWGLANLTAGDE
IILSVMEHHSNIVPWQMIAEKTEAVLKYVQLTNEEAFDFEHYESLLSERTKLVSVVHVSN
TLGNINPVEAIIKSARRFDAKVLIDACQSLPHMPIDVQAMDCDWLVGSGHKMCATTGIGF
LYGKKEILEAMPPFLGGGEMISEVYFDHSTYGELPHKFEAGTPAIGEAIALGAAVDYLSG
IGMERIQTYEAELTAYLFKKLADIPKLKIYGQQPDSKGHGRAALAAFNVEGIHANDLATL
LDHEGVAIRSGHHCTQPLHRLFEASGSARASLYFYNTFAEIDSFVAALKETIDFFTSMAE
Download sequence
Identical sequences K9PUX5
gi|427722166|ref|YP_007069443.1| WP_015132396.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]