SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015132399.1.56710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015132399.1.56710
Domain Number 1 Region: 75-357
Classification Level Classification E-value
Superfamily PLP-binding barrel 3.92e-61
Family Alanine racemase-like, N-terminal domain 0.0031
Further Details:      
 
Domain Number 2 Region: 457-574
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 0.000000523
Family Eukaryotic ODC-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015132399.1.56710
Sequence length 642
Comment arginine decarboxylase [Leptolyngbya sp. PCC 7376]; AA=GCF_000316605.1; RF=na; TAX=111781; STAX=111781; NAME=Leptolyngbya sp. PCC 7376; AL=Complete Genome; RT=Major
Sequence
MAISPSQSPDEHSWSVQDSERLYQIQGWGEPYFGINAAGHVQVAPTGEAEHGVDLFELVE
KLKNQGIQLPCLLRFPDILSDRLKRLNECFAQAIARYGYEGEYQGVYPIKCNQHRPVVEA
LLEAGQPYRFGLEVGSKPELMIAIAMLEPTSDHQPLLICNGYKDRDYIETALLATQLGHR
ALIVIEQPEELDLTLSASQALEIRPALGIRAKLASQGIGRWGSSSGDRAKFGLTVPQILQ
IVQTLRDKNSLDCLQLLHYHIGSQLSSIGVIKAAIREASQIYAELVLLGANVKYLDVGGG
LAVDYSGSKNNVPASKNYNMQNYANDIVATVKDSCDEKQVPAPTLVSESGRAIASHQSIL
IFDILSSSDITPTLPPEPSHREHLVIRNLRETYDFITLENYQETYHDAMQFKEEAISLFS
LGYLTLGDRGTAEQLYWCCCEKIFQIMQTAVSIPTDLQDLWQNMATIYYGNLSIFQSIPD
SWAINQLFPIMPIHRLDKRPNRRGIIADLTCDSDGRFNQFIDIKTKHKNLLELHPLNDKP
YYIGLFLMGAYQDIMGNFHNLFGRTNAVQVRLTEKGHSIDSMTQGSTVENILETVQYKHQ
ELLEKIKTQVDSAANRQKINIEQAQYLIDRYENNLKGYTYLN
Download sequence
Identical sequences K9PVQ6
WP_015132399.1.56710 gi|427722169|ref|YP_007069446.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]