SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015134013.1.56710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015134013.1.56710
Domain Number 1 Region: 45-301
Classification Level Classification E-value
Superfamily Pectin lyase-like 1.13e-23
Family Filamentous hemagglutinin FhaB, secretion domain 0.016
Further Details:      
 
Domain Number 2 Region: 1428-1578
Classification Level Classification E-value
Superfamily TPR-like 9.67e-19
Family Tetratricopeptide repeat (TPR) 0.033
Further Details:      
 
Domain Number 3 Region: 1338-1457
Classification Level Classification E-value
Superfamily TPR-like 0.000000000255
Family Tetratricopeptide repeat (TPR) 0.014
Further Details:      
 
Weak hits

Sequence:  WP_015134013.1.56710
Domain Number - Region: 352-505
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.01
Family Filamentous hemagglutinin FhaB, secretion domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015134013.1.56710
Sequence length 2029
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]; AA=GCF_000316605.1; RF=na; TAX=111781; STAX=111781; NAME=Leptolyngbya sp. PCC 7376; AL=Complete Genome; RT=Major
Sequence
MNTFLKFLICLSVGISPFFAVRGAAQPTPESSNSTQTNISELAPEQFLINGGVLSNDGRN
LFHGFEQFNLTTEQTALFLNQPNALNLFSKISGGNPSYIDGLIGVLNGNPNLYFINPAGI
IFGENIQLNVPNDFVATTATGLGFGNSWLNAVGNSDFANLVGEPTQFSFNTNGVVGDILV
QGDLDTPIGDLALIGGRVQGDRRISSSENLLITTVPDQGLVRLQQPGNLLSLELDTASLD
HGNGVNFSIQQFPQLLTGSGEIQLHDISAKYGVIAADGQLTLNNSSLQTDGHLALLGQGI
TTNSTTSNSGLNQLLISGELAESYQAQKPFLEAIANRINFTIESDPIDGTPIIVTDNLID
NVGAETLNTADIYLEKSQFTGQYIYLLGDNIDLIGSDIATTENLSLFALDTATLSDTSTH
ALDLSSRGILSLRGNDTLTVDFANHPNSKITSSDNILLSAGDLNLQEAVVETQNNLLINA
NDVLIQNSQLTSGQNLKVSAANSLLLEDIPDRLRDATFNSDLPLRLIAGNELRLESGDIL
RAIAPKENSIFQAGTTITAITPGEQIELLGNFKSSGDIQIGDLTTGEILIEGGVWQADQT
ISLLAEKNVILQDFHETRLGNYGSFDSPLNISANEITLVGNDLIELYLGDNSGLSSTDDL
AIFSEKINLVGSLTSAENIIVVADDINLGINTDRLDDTNIADILILGELPAKSFLKYEDF
WEASYFGGDLTAEKDIVLFANNILTLADLERKPLNLAGDNVVLQGLNRVSLDAANDPTSQ
IVATGDVSVLSDNYIGRVGLLTIGESKNILFSAPEIVLQGSLLNASQSISFDAAKSLSLS
KFQVFRLKSLPFQAIAPEINFSPSNNIRIDLSGVEGSKIRTEADLILDSAGDIYLSGDIA
TSGEFIVTAAGNIDVIQPKFTVGGNLRIAAGDRLFMEDIKGRGGTNELDYSPLQFLADGN
ITLQGNNAIEIPSYDSRSFIQSGGDTTLVSDGLILSNLEYRVGNDFSVEDLAGQPTDWQS
VVDVNNTLNQFLSVYFQEGEGLVPIGQVNLAEVYAEGDIRFGDFNGRSLILEAGETITAN
EINIYVPVAFGYANDEPTIRTRNFPDQVLSITGGKNFTEPAQALFIGTSLIPLPAEPIPS
LEPGLPAPPIIFEPSISVGGFFPLEEGTFDLDFSEVDQLFEAVSLNDPLIPLSFSRAIAV
GFGDGTFISNPEPNEVDSPEFFILNPPNARLLSSVSGNREVNSLGVNLKLLDNPLENATN
SNPNSVAATGLRGSGLTQDLTGQNTKNSDGITVIDGQTDEIKIKTAETCVNDDPRQKSLT
CQQEELRLARLTGNTTKELFALDQLGFFYYRNNHYQDALKAYQERLTLAENLENTIAEVQ
SLQGLTQTYSALGDYQTARVMNRRALALVSKIVAEDPEVLIPLKQSIASNFGFIAYAQEG
YPIAVKRYQQSLELARQSGDRNAEIEVLSQLGLSYFQQTDYQAAKSIQEQALALAQTADS
KLNQLRAYEGLAIAEYALENYDVAIQNFEQALALAEQLGDRHAQARNWSAIGDTQHQIQQ
NAIAITSLENAIQLWEELRQDLGAQDLFRVSLFETQESTYSTLQKVLIESGQFTKALEIT
ERGRSRAFVELLEDSNSPQADEQDIEAPDIDQMRQIAADQQATLVSYAIAREVVEQRGQR
DLVNSEIWIWVVQPSGTVDFRRQDLQSLTAQGLELDDLVSASRCFGDRVCLLRSQTQQVS
QGLVHADNAAVNFDPNLNQLHDLLIAPIQDLLPTAPEQEVVFVPHRSLFLVPFAALQDDT
GRYLIEDHTIRTAPSIQVLDLTRQQRQTVSGQGITIVGNPTMPKELEQLPGTEKEALAIA
AMFDTDIITGDEATPTLVTQSIANSRFIHLATHGLLDGYGDNDVQKRPGAIALAPTEVDD
GFLTASEILELDLNSEMVVLSACDTGRGTITEDGVIGLSRSFMGAGVPSVVVSLWQVPDE
STSDLMIEFYEQLRQNPNKAQALRQAMLVNLKKYGQPIDWAGFTLMGET
Download sequence
Identical sequences K9PZ98
WP_015134013.1.56710 gi|427723803|ref|YP_007071080.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]