SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015134163.1.56710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015134163.1.56710
Domain Number 1 Region: 12-234
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.61e-48
Family PP-loop ATPase 0.00036
Further Details:      
 
Domain Number 2 Region: 214-312
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 8.37e-18
Family MesJ substrate recognition domain-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015134163.1.56710
Sequence length 324
Comment tRNA lysidine(34) synthetase TilS [Leptolyngbya sp. PCC 7376]; AA=GCF_000316605.1; RF=na; TAX=111781; STAX=111781; NAME=Leptolyngbya sp. PCC 7376; AL=Complete Genome; RT=Major
Sequence
MNWSLLHARVHQHLKETQLLPTGQRILVAVSGGQDSLCLGQLLLDLSRRWQWRLAIAHCN
HGWSGDEAIADHVCRIAVTWQLPFFLCAAETPIKETEAAARQWRYQELGAVAITEQFSIV
VTGHTLSDRAETLLFNLARGSGLGGLGALTERRSLTSEVSLVRPLLTVHRDETAAFCTDF
NLPIYEDTYNHNLRFSRNRLRQQVLPELKVINSQAEQHLAQTAIISQAENDYLEAIAAEH
FAKYFAADLSLQRLPLRQIHPALQRRILKQYLIQLLPKQPSFQQIEACRKLIYAPNRSQT
SSFSGDIKFIVNAEYIVPLDKMKK
Download sequence
Identical sequences K9PY61
WP_015134163.1.56710 gi|427723957|ref|YP_007071234.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]