SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015134265.1.56710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015134265.1.56710
Domain Number 1 Region: 8-266
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.71e-58
Family Decarboxylase 0.00078
Further Details:      
 
Domain Number 2 Region: 289-480
Classification Level Classification E-value
Superfamily PRTase-like 3.36e-41
Family Phosphoribosyltransferases (PRTases) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015134265.1.56710
Sequence length 482
Comment bifunctional orotidine-5'-phosphate decarboxylase/orotate phosphoribosyltransferase [Leptolyngbya sp. PCC 7376]; AA=GCF_000316605.1; RF=na; TAX=111781; STAX=111781; NAME=Leptolyngbya sp. PCC 7376; AL=Complete Genome; RT=Major
Sequence
MELNYSQFNDKLTAAITRNQTILIAGLDPNPEMLPIAFNSGNLLVDLEKWLLGIIEQTSN
LVCAYKPTLGFYQAFGVAGFELLSKVLEKIPAELPVILDAKQADLNTSTIFAKTIFKTWN
VDAVTLSPYPGQDHIAPFLLYPDKAVFLQCRTSNPGALSIQAYPDLETPFYLHLVKETKQ
WGTPEQVALEIGGDRPETFARVRKIAPERWILARSIWQDKHPLEDILQAGLNSNGSGLLI
PVPNDFLSQENCTQTVDNLRQRIESIRTPFIPDQASCDIWKTELKFPNRHPQEKLILQLF
DLGCLMFGEYVQASGATFSYYIDLRKIISNPQVFNEVLKAYAEIVEKLDFDRVAGIPYGS
LPTATGLALKLKTPMIFPRKEVKAHGTRRLIEGHFEKGETIAVIDDILISGKSIVEGAQK
LESAGLVVKDMVVLIDHEGGVKDRIKAQGYNAYSVLTISEITETLFDTGRITKEQYDSLT
QH
Download sequence
Identical sequences K9PZD5
gi|427724060|ref|YP_007071337.1| WP_015134265.1.56710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]