SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015136372.1.56710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015136372.1.56710
Domain Number 1 Region: 60-360
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.07e-29
Family Filamentous hemagglutinin FhaB, secretion domain 0.0089
Further Details:      
 
Domain Number 2 Region: 334-432
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000001
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 
Domain Number 3 Region: 432-561
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000377
Family Filamentous hemagglutinin FhaB, secretion domain 0.046
Further Details:      
 
Domain Number 4 Region: 837-1002
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000392
Family Filamentous hemagglutinin FhaB, secretion domain 0.07
Further Details:      
 
Domain Number 5 Region: 702-830,872-902
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.0000113
Family Filamentous hemagglutinin FhaB, secretion domain 0.08
Further Details:      
 
Weak hits

Sequence:  WP_015136372.1.56710
Domain Number - Region: 563-692
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000116
Family Filamentous hemagglutinin FhaB, secretion domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015136372.1.56710
Sequence length 1209
Comment filamentous hemagglutinin family outer membrane protein [Leptolyngbya sp. PCC 7376]; AA=GCF_000316605.1; RF=na; TAX=111781; STAX=111781; NAME=Leptolyngbya sp. PCC 7376; AL=Complete Genome; RT=Major
Sequence
MLVVTVINKLSNLIDPKRLWVFLGFSHLFAMGATPSLAQVVAADSTVNTIVNGGGPFSIT
GGTQQLTTLFHSFSEFSPGTENVSFDLNMGQSTVDAIVGRVTGINASFIDGEISLTGGNN
PDLFLINPNGIAFGGNASLSLPGSFIASTADSVVFENGFEFSAIVPSTAPLLTVSVPIGL
QLGSYPGDITGNGPFLEVQSGQTFGLVGGSISFDDVLVEASEGRVELFAATDALVPLTTV
NGQQAFGTQPSVGEWRDIIFQNYSEIFNEGNGGGAVQLQGKRVSLQGRSRISVINEGSTA
AGDINIYGSEQIDVTGETSSGSPSRIISEVDENASIGGNGGDINIFTDQFLILDGGVVRT
EAESVENGGDINIRANHVELSGSGIDDGFSFLGSKVDDKANATGQGGDINIVTNQFRILD
GGEIRAETESAGNSGSINITADYVELSGVGADGGRSLLSSKVDDKVGATGRGGNVFIKTQ
TFLADDGALLGAESEGVGDAGDLILTVTGDAIFQGNTSGGSGSFVNLESEVSGAGGNLTL
RANRLFLRDGALFDADTEGTGKGGSIDLQAKLISLSGINGNGFSSTLTTEVDSSATATAQ
GGDILIQAERLELSDGALIESITDAAGSAGNVVINAQIIDLNGAVESRDITSINAGVFGN
VAGTGGTIILNTDILNLQDGATLNTSTEGSGDGGSIEVNARAITISGQSPSGVRSGFRAE
VAVGGSGQGGQIKIDTEDLTIQGGEITTSTAGKNDAGQIVIVSAGDINADASDIRSEVLL
GAIGNGGGINIKAQNLNFSNQSRVTVATNAQGNAGEIAVMAANDLNFTGNSQLISSVGDN
AQGNAGRIDVSAGGEITLNNSSFRSDVGIDAIGNGGSITVVGNNIDFSNNAQLTTTTRGI
GDAGRIEIKALDIVHLSSQSRVSSSAEATAIGNGGDIFFSARRFDLRDASIRANNLSDGG
QGGNVELVSRDRVILERSDITAITNSGDGGNLNLDVGEVLFLRDHSLLSTTAGQAGGGGN
GGNINLTAPLILSFPSENSDIVANAFTGNGGNIILTTKSLLGLAFRPQLTPESDITASSQ
FGVSGAVTINDFLADLESGLITTAASLTDPSDEIVQGCSSNRRNAFIATGRGGIPLSPNQ
TVSRDRLWMDTRNITSDIVASPIFSSPSLVTRPALTEANAWHTTSTGQVELIAVNASSPT
IGGGASCSG
Download sequence
Identical sequences K9Q4L6
WP_015136372.1.56710 gi|427726222|ref|YP_007073499.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]