SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015139874.1.5551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015139874.1.5551
Domain Number 1 Region: 48-164
Classification Level Classification E-value
Superfamily Tricorn protease N-terminal domain 5.23e-19
Family Tricorn protease N-terminal domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015139874.1.5551
Sequence length 174
Comment Tol biopolymer transport system periplasmic protein [Nostoc sp. PCC 7524]; AA=GCF_000316645.1; RF=na; TAX=28072; STAX=28072; NAME=Nostoc sp. PCC 7524; strain=PCC 7524; AL=Complete Genome; RT=Major
Sequence
MTKRIFIPIFACATLLSGCFGYPRLVSYPFDPGGRGINSLASELNPQTSGRYIVFTSDRR
GSQDVYMFDTLTRNLIDLPGLNALDTIASHPSVSDSGRYIVFAASRQGRSAIFLYDRETR
QSRNLTANLQAEVRNPTISADGSRIAFEFSNNGQWDISVYDRFGQPLNIPQDPR
Download sequence
Identical sequences K9QWJ3
WP_015139874.1.5551 gi|427730809|ref|YP_007077046.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]