SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015141423.1.5551 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015141423.1.5551
Domain Number 1 Region: 146-426
Classification Level Classification E-value
Superfamily Subtilisin-like 8.12e-83
Family Subtilases 0.00000385
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015141423.1.5551
Sequence length 616
Comment subtilisin-like serine protease [Nostoc sp. PCC 7524]; AA=GCF_000316645.1; RF=na; TAX=28072; STAX=28072; NAME=Nostoc sp. PCC 7524; strain=PCC 7524; AL=Complete Genome; RT=Major
Sequence
MRKLIILCLFVIGLVSAVFGFLNFQGLAAKGEFETILLDFREDIPAEVIKQDLQAIAQKY
NVTPQLDNKFSAQDNVYIIKGDRDRLKELKKSPFAKATEIIEPNYIYKLIEPAAKPTWLG
ELLRPQDSEEVQPSLTAPNDEYYSKQWNLHKIGVESAWSQTKGSGVTVAVIDTGVTKVRD
LYETKFVKGYDFVNDKEEASDDNGHGTHVAGTIAQATNNKYGVAGIAYEAKLMPLKVLSA
YGGGTVADIAEAIKFAADKGADVINMSLGGGGESQLLKQAIDYAHSKGVVIIAAAGNENE
NSAAYPARYPYVIGVSAFGPDGEKAPYSNFGAGVDISAPGGTDAGAILQETINEEGESVF
LGLQGTSMASPHVAGVAALVKAKGIQEPEEILKVLKQSARVIKDDSLNYYGAGQLNAEAA
VKLATDGQISFQDFFRWLRDNGYLNPGFWIDGGAVALLPKILMVVGSYLLAWFLRVYFPF
AWSWSLSSGLIFGSSGLFFLQGIYIFDLPQWPFRVLGSSIPELGNTIQGTGALNPIFASV
LIPIVLMALLLGHPNWKWFAIGSTLGVAACLTVSAVLDPAVWGLGSENLARIFLIANALL
CYGLARLALKNEGQTA
Download sequence
Identical sequences K9R110
WP_015141423.1.5551 gi|427732379|ref|YP_007078616.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]