SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015163451.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015163451.1.5078
Domain Number 1 Region: 5-268
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.62e-46
Family Protein kinases, catalytic subunit 0.0000883
Further Details:      
 
Domain Number 2 Region: 1352-1525
Classification Level Classification E-value
Superfamily GAF domain-like 1.72e-26
Family GAF domain 0.0054
Further Details:      
 
Domain Number 3 Region: 1538-1659
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.38e-19
Family Heme-binding PAS domain 0.033
Further Details:      
 
Domain Number 4 Region: 302-501,537-599
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000221
Family RecA protein-like (ATPase-domain) 0.071
Further Details:      
 
Weak hits

Sequence:  WP_015163451.1.5078
Domain Number - Region: 817-859,1139-1179,1235-1274
Classification Level Classification E-value
Superfamily TPR-like 0.000308
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 
Domain Number - Region: 1735-1943
Classification Level Classification E-value
Superfamily PP2C-like 0.000916
Family PP2C-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015163451.1.5078
Sequence length 1945
Comment putative PAS/PAC sensor protein [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MLNLPGFRISHQVSHNSKRVIFRGVRTIDNLPVLLKSIPDEYPSPTKILRLKHESTIARN
LNIPGIVKALTLINSAPAPVIVLEDFDGILLKDLLSDRRFTLREFLEIMIQLTETLSALH
QQNIIHRDLNPYSILINPTTLQVKIVNFMCAASQLATLNQVMRTTSYADLPDGNLAYVSP
EQTGRMNRSVDYRTDFYSLGITCYELLTGHLPFDQLDALELVHCHIARQPADVQEVNPDI
PVVLSDLVMKLMAKNAEERYQTAWGLKSDLQECLRLLVEDGDRPFIPTFPLAEHDLASHF
QIPAKVYGRDRQLQQIEAAFERTSTGAAEMLWISGQAGLGKTTLIKEACQFIAQQRGYFM
LCKFDQYQRNIPYGRLIAAFSEFIRTILTETEAQLQRWREILLENLAGNGQVIVDIMPEL
EIIIGKQPSLPALGAIESQNRFNLVFQNFARAFCRIHYPLAIFFDGLQWADPTTLNLLEL
IMMDNQIHSLLLVGAYRPSKVTLHEEQSPSVKPETPTNSANHSDRLLLATIARIEAMQSH
PVSAIDLPAWQRQQVVQLLADTLHTQAENVEPLAEVVLAKTLGNPLFVIEFIQQLAEQKV
IQFNAKSISWRWDLSQAERLSITDNAVDLMVAKLQKLPTATHDLLQVAACVGDAFGAKFL
GMIVDCDPAAIENQLIPATKAGLLVQYYLIETSDQKSLSFLFGEEVEYRFAHDRVQKAAY
ALLEDQRQQQLHLQIGRVALAKYEQHPTSASEQIFDIVEQLNLGQELVHNRQEKHQLARL
NLLAGQRAKQATAYALAINYFQVGTDILLHDCWQTEYQLAFELFRDRAECEYLCGNFAAA
TEFFQLCLEHAQNVQDRIDIYIIQLVLWINQNRNLEAIDLGRDGLQQLGLEPLPRHPDRD
LILQRVNQIKAQIKLTLSSHNLAQIENLVDLPNMQSPTLQQAMKLMQYMAAAAIRCDRSF
YILVILAMVQLSLEHGNCGTSVYAYSAYGSILGAGFNEYENGHQFGKAALALSDKFSTLA
GISHFSYGGFIGHWRRPFSECLQYLIHAFQLCAASGELLYAVYTLVLIAETAIISGTSLG
NAFNEVMRCKQLAQQRQYEAIVNNALVMQQYVLCLQGQTDSVTDFSDRHMDEASLFDRLH
HSGQADSALSRYYIYKAQLHYLFEQYDHALEWIIKSRQIIDIHFGVAIFAEHFFYESLIL
AAIYDSAELDERRDYSRLLKHNERRLARWSQNCPANFRAKHLLLKAEIARICNRQLLAIN
LYDEAIAVAKQYKFIQIEALGLELAAKFWLAQQKFDFAQLLFKKAYYTYQIWGAAAKVSH
LETAYAQMLATTFRQASKESTDYGHGSLDIATVVKAAQTISSEIVVDKLLAKLMVIMLET
AGASRGCLVLLRQQSLYIEAEAIVNQPEVARPSIPVAESDYLPLSIINYVARVKEPVLLD
NALQLGRFTQDPQVQAQQMQSVLCLPIINQGKFLGLLYLDNNLVVAAFTPERREVLQILC
AQVAISLENAKLYEEQGNYSRLLEQTVAERTKELEQEIHERKRAETALQASEAELRALFA
AMTDVIFVTDANGNFIRIAPTNPKYPSRRLDEIVGQNMSEFFPDRQALKFRTRIQQTLNS
QATQNIEYEMNLEGRKVWFAAILSPISRTEVIWVARDITDRKLSEQALQESMARLESANQ
EITLLSEQLKAENLRMNAELNITRQLQQMMLPKEAELRQIPGLDIAGFMEPAQEVGGDYY
DVLSHNGRVKIGIGDVTGHGLESGMLMVMVQTAVRTLLLDEQTDGNRFLNAINKAIYHNV
QRMNSDKNLTLALLDYEVVPQGGRLQMYGQHEEAIVVREGGQIERIDTIDLGFPIGLEPD
IAEFVGQTGIDLAPGDSVVLYTDGITEAENPAHQQYGIERLCEMVRQNWHQSADRMRELV
IEDVRRHIGTQRVFDDFTLLVLKQK
Download sequence
Identical sequences K9SCY0
WP_015163451.1.5078 gi|428216440|ref|YP_007100905.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]