SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015163947.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015163947.1.5078
Domain Number 1 Region: 167-436
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.83e-71
Family Extended AAA-ATPase domain 0.000000063
Further Details:      
 
Domain Number 2 Region: 423-616
Classification Level Classification E-value
Superfamily FtsH protease domain-like 1.24e-67
Family FtsH protease domain-like 0.00000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015163947.1.5078
Sequence length 634
Comment membrane protease FtsH catalytic subunit [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MPIRNEDPKGPRSWNIGNILLLIGAGLLIFNLVFPLVSGPQIPQVPYSMFVHQVKSGKVE
KAYVGQDQIRYKLKDGIESKDSEVLATTPIFDLELPKMLESNKVEFAAQPPQRGNWFTTL
LGWIIPPVIFVGIFQLFARRGAGGGMPGGLQIGRSKAKVYVEGDAPGIRFDDVAGVDEAK
TELVEVVEFLKTPEKYTSIGAQIPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSEF
IELFVGVGSSRVRDLFEQAKKQSPCIVFIDELDAIGKSRASGGMLGGNDEREQTLNQLLT
EMDGFTDDGTTVIVLAATNRPEILDPALLRPGRFDRQVLVDRPDKSGREAILKIHAKKVT
LDPEIDLKVVAGRTSGFSGADLANLVNEAALLAARAGRKNVTLADFSEAVERVVAGLEKK
SRVLSDKEKKIVAYHEVGHALVGALSPGSGRVEKISIVPRGMAALGYTLQIPTEDRFLMS
KEELQAQIAVLLGGRSAEEIIFNSITTGAANDLQRATEMAQQMVTNYGMSEILGPLAYQQ
QSNSFLGGGNNTGRELSPATAQLIDKEIKDIVESAHQSAIAILRENRELLETVSEKLLED
EVIEGEFLQEVLAKVSKPEFMEQNANSDRHLQPT
Download sequence
Identical sequences K9SFK3
gi|428216936|ref|YP_007101401.1| WP_015163947.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]