SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015164355.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015164355.1.5078
Domain Number 1 Region: 120-216
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 2.49e-37
Family Ribosomal protein S3 C-terminal domain 0.0000182
Further Details:      
 
Domain Number 2 Region: 2-97
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 3.14e-30
Family Prokaryotic type KH domain (KH-domain type II) 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015164355.1.5078
Sequence length 251
Comment 30S ribosomal protein S3 [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MGQKVHPNGLRVGVIRPHLSRWFADGDRYPILASEDFEIRKYITKTLDNAGVADVRIERK
ADQVDIEIRTARPGVVVGRGGSGIDQLRQGLLKHLGKVGTKEKTGTSQIRINVVEVARVD
AEAALIGEYIAQQIERRVSFRRVVRQAIQRAQRAGVEGIKVQVGGRLNGAEIARTEWVRE
GRVPLHTIRADIDYAYRTASTVYGIIGVKVWIFKGEIEPGQEAAAPAQPQPRRRQQQRRR
PQFEDRSGAEG
Download sequence
Identical sequences K9SFJ9
WP_015164355.1.5078 gi|428217345|ref|YP_007101810.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]