SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015164730.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015164730.1.5078
Domain Number 1 Region: 17-318
Classification Level Classification E-value
Superfamily Pectin lyase-like 2.86e-30
Family Galacturonase 0.055
Further Details:      
 
Domain Number 2 Region: 290-562
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.43e-21
Family Galacturonase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015164730.1.5078
Sequence length 744
Comment hypothetical protein [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MAIITVTTTLDVIAADGLTSLREAIIEANANADAADTIILESGLTYDLTLVGAGEDAAAT
GDLDIDSVVAGANITIETDGAAQATVDATALGDDRILDVLNADATLNIDNLILTGGNVTA
AGEDGGAIDLITGATLNVTDSEITGNTAADNGGGIAGDADNTITITNSLITGNEATGSDG
GGVYFDDNGNLTVTNSTVSNNTANTDGGGIHFDADGTATITNSLITGNEATGSDGGGVYF
DDNGTLTLTDSTVSNNTAGGDDGGGIHFDADGTATITGSTITGNTASDDGGGFYTDNRGN
LTLTDSTISNNTATGDQGGGIHLDNDSTATISTSTISGNSAGSDGGGSFFDNNSTIDITD
STFSGNEAGDESGALEADTPTLTISNSTFSGNTAATAGGAIQIDDGGTVDISHTTIAFNT
ATTNAGGIDLNDATITLNINNTIVATNEAPVGPDIDNTVGATITSGGFNIIGDNTDVAAD
FPAGIPNANDDFVGTAMDPIDPGLSPLADNGGPTQTHALGDGCSLAINNGDPNFVAPPDF
DQRGMGFDRVFGGRIDIGAFELQNSAGVLVFGNTSFGTPGPDTIVGDANNNTINGNGGDD
SLFGSDGIDRVNGGLGNDFLGGGLGNDFLNGGAGNDTMDGACGGTGTGEFDRLTGGGGAG
ADTFILGASFGSYYLGNGDADFAYISDFNSGVDTIVLNGVLADYTFVPNTTSNNVTGQGI
FNGGDLVAIVQQQAINTVTDLVFV
Download sequence
Identical sequences K9SIJ8
WP_015164730.1.5078 gi|428217724|ref|YP_007102189.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]