SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015165051.1.5078 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015165051.1.5078
Domain Number 1 Region: 95-229
Classification Level Classification E-value
Superfamily Cysteine proteinases 7.85e-33
Family NlpC/P60 0.000013
Further Details:      
 
Domain Number 2 Region: 6-69
Classification Level Classification E-value
Superfamily Prokaryotic SH3-related domain 0.0000000375
Family Spr N-terminal domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015165051.1.5078
Sequence length 238
Comment NLP/P60 protein [Pseudanabaena sp. PCC 7367]; AA=GCF_000317065.1; RF=na; TAX=82654; STAX=82654; NAME=Pseudanabaena sp. PCC 7367; strain=PCC 7367; AL=Complete Genome; RT=Major
Sequence
MLNYDRLYHSNQNINLYSSPDLQELVTQVAGGLCLQVLSDLPDPLADIQKPIQVQLLADA
YVGYLNPIDRHKLIAIASEDLDAYRPLALTRSEIESRIDQAIAFAKVAMACPNEYLWGGT
VAPNYDCSGLVQAAFGSVGVQLPRDSYQQEAFLEPIEIAKLEPGDLIFFGSTTKTNHVAI
YLGAGQYIHSSGKDSGRNGIAIDCLAGGDPIASKYAAQIRGAGRINHCYQGVWQAAAF
Download sequence
Identical sequences K9SIW7
gi|428218048|ref|YP_007102513.1| WP_015165051.1.5078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]