SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015167562.1.58188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015167562.1.58188
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily Ribosomal protein S19 9.42e-36
Family Ribosomal protein S19 0.000019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015167562.1.58188
Sequence length 92
Comment 30S ribosomal protein S19 [Synechococcus sp. PCC 7502]; AA=GCF_000317085.1; RF=na; TAX=1173263; STAX=1173263; NAME=Synechococcus sp. PCC 7502; strain=PCC 7502; AL=Complete Genome; RT=Major
Sequence
MSRSLKKGPFVADSLLTKIENLNAKGEKTVIKTWSRASTILPQMIGHTIAVHNGKQHVPV
FVTEQMVGHKLGEFSLTRTFRGHAKGDKKARR
Download sequence
Identical sequences K9SRQ1
WP_015167562.1.58188 gi|428220868|ref|YP_007105038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]