SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015169715.1.58188 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015169715.1.58188
Domain Number 1 Region: 224-555
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 7.78e-42
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0036
Further Details:      
 
Domain Number 2 Region: 4-130
Classification Level Classification E-value
Superfamily CheY-like 3.56e-21
Family CheY-related 0.004
Further Details:      
 
Weak hits

Sequence:  WP_015169715.1.58188
Domain Number - Region: 144-208
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00116
Family Thioltransferase 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015169715.1.58188
Sequence length 560
Comment fused response regulator/thioredoxin-disulfide reductase [Synechococcus sp. PCC 7502]; AA=GCF_000317085.1; RF=na; TAX=1173263; STAX=1173263; NAME=Synechococcus sp. PCC 7502; strain=PCC 7502; AL=Complete Genome; RT=Major
Sequence
MLKPVILTVDDDPEVLQALARDLRQQYGDRFRIVRADSGAMAIGTIQKLKLRNEPIALFL
VDQRMPKMNGVEFLEQALEIFPSAKRVLLTAYADTDAAISAINLTQIDYYLLKPWDPPEE
KLYPVLNDLLDDWFANFRPPFEGIRVIGNRWSPQSHDMKDFLTRNQIPYQWLDIELSEEA
QKLAALANCDRPSLPLVLFTDGSCFLHPSIAQVAEKIGLRTQAEKPFYDLIIVGGGPAGL
AAAVYGASEGLHTVLIEREAPGGQAGTSSRIENYLGFPSGLSGNDLARRAVTQARRFGVE
ILSPQEVTGIRVEDTYRFITLSDGSEISCHALILAMGVSWRRLDVLGLDRLTGAGVYYGA
AQTEALTCQDEDVYIIGGANSAGQAAMYFSKYARQVTMLVRGESLTKSMSQYLIEQIAET
PNIRVQTHSIVIEVKGETSLEEIIIQNTITGETETVPSVSLFIFIGAVPRTEWLDGLVER
DDRGFVFTGTDLKSGAPVSGVHRPKGWRLDRDPYLLETNIPGVFAVGDVRHGSVKRVASG
VGEGSICVQFVHQYLAKVGS
Download sequence
Identical sequences K9SZ44
WP_015169715.1.58188 gi|428223029|ref|YP_007107199.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]