SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015170557.1.54702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015170557.1.54702
Domain Number 1 Region: 50-112,178-342
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 0.00000903
Family Isochorismatase-like hydrolases 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015170557.1.54702
Sequence length 348
Comment hypothetical protein [Geitlerinema sp. PCC 7407]; AA=GCF_000317045.1; RF=na; TAX=1173025; STAX=1173025; NAME=Geitlerinema sp. PCC 7407; strain=PCC 7407; AL=Complete Genome; RT=Major
Sequence
MTQSVSHSLPLPPHFEAGRVGQVWRVPYQARAEQARAWAKQHAIAPAAKDKTRLCLMAID
VQNTFCIPDFELFVGGRSGQGAVQDNVRLCEFIYRNLGLITEIAPTMDTHTVMQIFHSQF
WVNDAGDNPPPMTTISLAQVQQGHWKVNPAIAHSLAKGNYLLLQSYALHYVQTLSQDGKY
PLTIWPYHSMLGGIGHALVSAVEEACFFHNIARHSQTNFEIKGGNPLTENYSVLRPEVLD
GPDGRPIAQKNTRFIQKLLEFDAVIIAGQAKSHCVAWTIADLLSEIQAQDPALAKKVYLL
EDCTSAVVVPGVVDFTDQADAAFQRFADAGMHLVRSTEAIAHWPDLSL
Download sequence
Identical sequences K9S5E6
gi|428223944|ref|YP_007108041.1| WP_015170557.1.54702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]