SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015172594.1.54702 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015172594.1.54702
Domain Number 1 Region: 6-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.28e-68
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000599
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 2.62e-41
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015172594.1.54702
Sequence length 327
Comment transketolase [Geitlerinema sp. PCC 7407]; AA=GCF_000317045.1; RF=na; TAX=1173025; STAX=1173025; NAME=Geitlerinema sp. PCC 7407; strain=PCC 7407; AL=Complete Genome; RT=Major
Sequence
MAETFMFNALREAVDEEMARDPSVFVLGEDVGHYGGSYKVTKDLYKKYGDLRVLDTPIAE
NSFTGMAVGAAMTGLRPIIEGMNMGFLLLAFNQIANNAGMLRYTSGGNYKIPMVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTAYNAKGLLKAAIRDDNPVLFFEHVLLYNLK
ENLPDEEYVLPLDKAEIVRRGKDVTILTYSRMRHHVTQALKTLEKEGFDPEVIDLISLKP
LDFDTIGESIRKTHRVIVVEECMRTGGIGAEIVASINDRFFDELDAPVLRMSSQDIPTPY
NGALERLTIVQPEDIVEAVRKMVALRV
Download sequence
Identical sequences K9SA48
WP_015172594.1.54702 gi|428225985|ref|YP_007110082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]