SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015180977.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015180977.1.75295
Domain Number 1 Region: 719-890
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-60
Family GAF domain 0.00015
Further Details:      
 
Domain Number 2 Region: 534-705
Classification Level Classification E-value
Superfamily GAF domain-like 8.94e-60
Family GAF domain 0.00011
Further Details:      
 
Domain Number 3 Region: 1182-1359
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.27e-39
Family Histidine kinase 0.005
Further Details:      
 
Domain Number 4 Region: 896-1060
Classification Level Classification E-value
Superfamily GAF domain-like 5.02e-31
Family GAF domain 0.003
Further Details:      
 
Domain Number 5 Region: 252-405
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000000458
Family GAF domain 0.045
Further Details:      
 
Domain Number 6 Region: 39-141
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000127
Family PAS domain of steroid receptor coactivator 1A, NCo-A1 0.067
Further Details:      
 
Domain Number 7 Region: 436-534
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000224
Family Heme-binding PAS domain 0.078
Further Details:      
 
Weak hits

Sequence:  WP_015180977.1.75295
Domain Number - Region: 1092-1131,1161-1189
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000353
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015180977.1.75295
Sequence length 1366
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MSHLRKKADLRQSQPVNYNTKKRQIEEDEAIYKKKSQLEEFQALYESLPCIGFSLDSTGR
ILAVTQFGAAYLGYRVTELTQKSIVSVFEPEYPAIFQSQLAGVQQQANSIQKWEVQLVHK
NGRLLSVKVSACLVPGTQSNPIINLVCEEIPPYKPSEHTAQKSEESFPATFAPHPYSVTQ
IDQNNYSITEKEFEHSLEEVCAQEYNLVLSRAFNKSLQTEAAVLDKSQALANFSSNLKQL
HRLKTAKYESSEKLFSEYLQTGCEIFKLSTGIVSQINGQAYFIRSVKSNFDILNPGLKLE
LKYTACAAVIEEQKTIAYNRISQSEPISDSSIAQAWRVQSYIGTPIFVNHKIYGTLNFSS
FQARSTDFEVYEQEIIELMAQSIGSFIADEQGKIEHQKMLDALQEKEARFRAAVEGSLDS
FFVFQSVRDETGCIEDFVFVDINSNGEKLISMSKAEVLGKKLCQLFPINRTAGFLEKYVR
VVETGEVLEEEFPISVEGITASWLHHQVIPLADGIAITTRDITERKQSEEALRQQFLKEQ
LIRTIAGRIHQSLNLKEILNTTVAEVRQFLNCDRVLIFRLHADGSGVVVVESVGGEWIPM
SGTVINDHYLAQSYIQLYQQGRIQAIEDIETATLAPCHRELLAQFQVRANLVVPIVHEEQ
LWGLLVAQQCSAPRQWQALEIDLLKSLSTQAAIAIQQSELYQQAQAEIIQRQQTEEALRQ
QFQRERLIGAIAGRIRRSLKLEKILNATVAEVRQVLQTDRVIIFRFQPNWSVNVVVESVA
SSSFSILGKNIYDPCFEQEYVLPYKQGRVMALEDIYTANLDPCHLNLLAQIQVRANLIVP
IVNNNQLWGLLVAHHCCEPRQWQSWEIDLLSALAAQAAIAIQHSQLYEQTKSHFLQEQLL
NQLTQAIRSSLDLETIFATAVREIGSLLKVDYAHIVQYLPEQKLWLTVSEYRKSLDLPVA
LGIKIPDENNPLADQLKRLEIVKIHDADTCEDAINQDYAKTFPGAWLLVPLHFGDSVWGS
LGLVKNTCPYHWQDWEVELIGAVAAQIAIAIQQAELYQQSRSATAQAQLHAQQLEQTLIE
LQNTQGYLVQSEKMSSLGQLVAGVAHEINNPVSFIYGNLVHASGYTQDILGLIELYQQHY
PHPVPEIQSEIDAIDLDFLIEDLPKLLSSMKLGAERICEIVAALRNFSRIAEAEVKAINL
HEGLDSTLMILQNRLKASGKHPEIQVIREYGNLPLVECYAGQLNQVFMNLLVNAIDAIDE
YNQTRAMEEIKTHPSFIRVCTELVNDHEVAIRIADNGPGMTEDVKRRLFDPFFTTKPLGT
GTGLGLSISYQIVVEKHGGQLRCYSQLGQGTEFVIQIPLLQGTTDG
Download sequence
Identical sequences K9WBB1
gi|428309246|ref|YP_007120223.1| WP_015180977.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]