SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015181245.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015181245.1.75295
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily CheY-like 1.71e-44
Family CheY-related 0.00044
Further Details:      
 
Domain Number 2 Region: 474-649
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-38
Family Histidine kinase 0.0019
Further Details:      
 
Domain Number 3 Region: 669-786
Classification Level Classification E-value
Superfamily CheY-like 2.42e-26
Family CheY-related 0.0044
Further Details:      
 
Domain Number 4 Region: 294-405
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.54e-21
Family Heme-binding PAS domain 0.065
Further Details:      
 
Domain Number 5 Region: 155-275
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.66e-20
Family Heme-binding PAS domain 0.037
Further Details:      
 
Domain Number 6 Region: 413-480
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.0000000000334
Family Homodimeric domain of signal transducing histidine kinase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015181245.1.75295
Sequence length 788
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MNFEPIEKSVILLVDDTPINLEVLLDLLEDSDFNVVVAEDGESAIEMAEYAPPDLILLDV
LMPGMDGFETCRRLKANQTTQDIPVIFMTALTENVDKVKGLNLGAVDYITKPLEHEEVLA
RVNIHLRLRHLTKRLTEQNEQLQQEISERQRAQEEREQAFTALRQSESRFRRLVESNIIG
IICTELNGSITDANDAFLQIVGYERSELLRGNLRWDDMTPLEYRDLDEKAIAELITSGVC
TPYEKEFIRSDGSHIPIMIGAVLLEESQQSAVGFVLDLSERKIAEQKIREQAALLDITTD
AILVRDLNRKIRFWNEGAERLYGWKAQEVMGKDAHELLYRRETLDQLEESWKSLAEYGTW
HSELYQFTKEGKEIIVASRWTLVRDKNGQPKSILTVNTDITEKKQLEAQFLRTQRMDSLG
TLASGIAHDLNNALTPMMMAAQLLECKLPDEQSQQWLSILETNVKRAADLVKQVLLFSRG
VAGKHTPLEVGYLIKEIEKIVKQTFSRAIEICSELPTQNLWTISGDLTQLHQVLMNLCVN
ARDAMPDGGTLQISARNFWVDAHYAQMNIEAKVGPYIVITVSDTGTGISREIIDRVFEPF
FTTKEIGKGTGLGLSTAIGIIKSHGGFVKVLSKVGKGTQFQVYLPATPTTKTDCPSEEHE
ELPRGHGELILVVDDEDSIRDITKTLLETYGYKVLLASDGIEAIALYTQNKEKISVVLID
MMMPNIDGPTTIGVLQKINSQVKIIAISGLVSNHKLSQFLGNSVKTFLSKPYTSDELLRN
LQLVLSID
Download sequence
Identical sequences K9W9Q7
gi|428309514|ref|YP_007120491.1| WP_015181245.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]