SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015181729.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015181729.1.75295
Domain Number 1 Region: 668-846
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 5.11e-37
Family Histidine kinase 0.0044
Further Details:      
 
Domain Number 2 Region: 280-408
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.34e-30
Family Flavin-binding PAS domain 0.038
Further Details:      
 
Domain Number 3 Region: 407-535
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-29
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.023
Further Details:      
 
Domain Number 4 Region: 183-292
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.58e-22
Family Heme-binding PAS domain 0.011
Further Details:      
 
Domain Number 5 Region: 46-146
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000082
Family Flavin-binding PAS domain 0.063
Further Details:      
 
Domain Number 6 Region: 575-615,645-675
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000216
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015181729.1.75295
Sequence length 848
Comment PAS domain-containing sensor histidine kinase [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MEDSITQSHQSEATLSKSELRWRRISARVPGVIYQFLRYPDGTLAFPFISPSCRRIFEVE
AIEIEADASVLMSMIHPQDEEDFNRSVTHSIETLQPWSWEGRFILPSGQIKWIQAASAPE
RQADGEILWDGLLIDITARKQAEDELWQTRKELEHSVEERTGELSPVNEPLRFTQFSMDY
APEAILWMDGEAHFFYVNEAACQMLGYSRKELLSMSVYDVDPNLPAQSWPEYRKKLKPLG
SVTLESTNRAKDGRIFPVEISINHLEFKGQEYNCIFVRDISERYKAKEALQQSEQKFRSM
VENANDIIYQLTPDGIFSYVSPNWVELLGHEISEVEGKVFTLFVHPDDVPVCLGTLRRAI
EKAQNQSGVEYRVRHKTGTWRWYISNLSLLRDASGRVVSVIGIARDISDRKQAEDALRES
EERFRNLVESTNDFIWEVDRNAIYTYVSPQIKDTLGYEVAEVLGKTPFDFMPSEEACCVS
ELMSNRVALRQSITNLENSNFHKDGHIVVLEMSGVPFFDQAGNFQGYRGIDRDITKRKQT
EEAVRQSKVQLQRQANQLEQTLRKLQNTQAQLIQTEKMSSLGQLVAGMAHEINNPINFIY
GNINHAHNYISDLFYLINLYQKNLPHSTLEIAAKIDEVDLDFVIEDFPKLLDSMKLGAER
IRKIVQSLSTFSRVDEAAVKEVDIHQGIDSTLILLEGRLKPPLNSQTIQVIKDYSNLPLV
KCYPGELNQVFMNLLNNAIDALEKQNRHQNFAEISANPGMIKIRTEISSKSASKPWIVIR
IVDNGSGMTEEVSSRAFDPFFTTKPVGEGTGLGLAISYQIVVELHKGRLYCISSPGQGTE
FVIELPNF
Download sequence
Identical sequences K9WCW5
gi|428310003|ref|YP_007120980.1| WP_015181729.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]