SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015181741.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015181741.1.75295
Domain Number 1 Region: 680-852
Classification Level Classification E-value
Superfamily GAF domain-like 3.71e-29
Family GAF domain 0.0057
Further Details:      
 
Domain Number 2 Region: 994-1120
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-20
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.055
Further Details:      
 
Domain Number 3 Region: 1120-1243
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.32e-19
Family Heme-binding PAS domain 0.047
Further Details:      
 
Domain Number 4 Region: 1454-1573
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 7.33e-18
Family Histidine kinase 0.047
Further Details:      
 
Domain Number 5 Region: 1242-1362
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 9.07e-17
Family Heme-binding PAS domain 0.018
Further Details:      
 
Domain Number 6 Region: 859-977
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000082
Family PYP-like 0.065
Further Details:      
 
Weak hits

Sequence:  WP_015181741.1.75295
Domain Number - Region: 112-225,562-628
Classification Level Classification E-value
Superfamily TPR-like 0.000285
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015181741.1.75295
Sequence length 1574
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MAIVCEKSPKAIFQDLLEAIQSGLIQPLSELDEDLLVQEYKFLHDRVQQAAYALIDESQK
QVVHLQIGGNLLEKTSPEQRSDRLFEIIDHLNQGIELVTAQPERTEIARLNLIAGQKAKA
ATAYEAAFKYFTTGIQLLNPESWQSEYDLTLALYSEAAEAAYLHGCFDEMEQFVEVVLVH
AKTVVDKVQVYDSRIQRHLSQGNLKEALKIGLEVLKLLGVILPENPSELDVRGGLESTAA
LLAEREIEDLINLPEMTAPEPLAAMSILASIGATAFIVSTALQVLIACKMVNLSLDYGNS
TWSPMSYAAYGVVLCGVVKDIELGYKFGKLALGSLERLNTKKRDAKAFVVSVALIMHWKV
HLRNTIPMLIDAYQNGVDTGDFEFAGYAACDVCYNSFFVGEELTQLEQKTATYSKAVDRI
RRESPSTWIAIVWQTILNLLDRSENPSRLVGRVCNEEQALPHALEVKDGTAIQMLYLHKV
ILCYLFEEYHQAVQSAILARQHFEEVTATKVLPVFCFYHSLAFLSLSLDASNSEKVAWLN
CVNTNQEKMQKWAEHAPMNYLHKFYLVEAEKARVLGQFLEAEEFYERAIAGAAENEYIQE
EALAYELAAKHYLARGREKIAQTYMKEAHYCYSRWGAIAKVKDLEKRYPQFFCQSSRAAS
ASVPITAETISNSFHTAFDLAAVMKASQAISREIELKQLLRSLMQILIENAGAQTGYLIL
ENSGEWSIEAACELNAEENACATQVLQSTPIAAQLPESIIQYVIRTLKPVTLNDATREDA
FINEPYIQQNQPQSIFCLPLLNQAKLVGVLYLENRLAAGVFTPERSQVLQLLSTQAAIAI
ENANLYSELRAKESKITQFLEAIPVGIGIVDATGRLYYTNQCGNQLVGKETDPSIAPEQI
SEAYQLYVAGTDQVYPAESLPIVQALKGERIRTEDIEIRRDHVSILLEARGTPVFDQQGN
IIYAIATFQDITERKQAEKLLADYNCTLEQQVAERTAALRQSEANYRNLLQTANSVIVRY
DPQGRIHYINDYGVKLLGYEEHEILGRTLFETILPDIELSGRDMKPFVHDLLRNPQSYPR
GEGENLCRDGRRVWMEWSNQAIFNDQGDVVEILSVGNDTTQRRQAEEALQRSEAKFRAIF
ANSQVGIYRTRIGDGLILDANQRFAELFGFDSPQEMIGIEHTIGYWVNPSDRQRGIEVMK
RDGEVRSFEAQLQKRDGTVFWGLFSSYLNAGDDYIEGVLADISDRKQAEAALQVSESKLR
TLIEAIPDPLFVFSAEGRFLEIMVLEPNLLWQPFEEMIGKTMHQLGREEADEFLGYIQQV
LRTQQILTVEYGAFLNGREMWFSARIAPISHDQVIWLVRDITAQKQAEATSILEERNRMA
REIHDTLAQSFTGILAQVGAAKQVLTDDLEATGAHLDLIKELARTGLTEARRSVVALRPQ
LLEEGSLQSALHRLVAQVRAAAMDTTLYYEIEGAVYALPSEVESNLLRIGQEALTNAIRH
AHADEIRVELVYKYDQFLLRVKDNGQGFGVGSIPSSEGFGLLGMSERAERIGAQLTIRSQ
PGHGTEIIVTIDRE
Download sequence
Identical sequences K9WCX8
gi|428310018|ref|YP_007120995.1| WP_015181741.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]