SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015181805.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015181805.1.75295
Domain Number 1 Region: 585-769
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.87e-69
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000166
Further Details:      
 
Domain Number 2 Region: 428-552
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.17e-24
Family Flavin-binding PAS domain 0.02
Further Details:      
 
Domain Number 3 Region: 157-266
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000773
Family Heme-binding PAS domain 0.016
Further Details:      
 
Domain Number 4 Region: 264-455
Classification Level Classification E-value
Superfamily GAF domain-like 0.000000000262
Family GAF domain 0.0099
Further Details:      
 
Weak hits

Sequence:  WP_015181805.1.75295
Domain Number - Region: 21-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0247
Family BphP N-terminal domain-like 0.094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015181805.1.75295
Sequence length 781
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MSSLLNKLLSLLTIRRKEYLTIDRDFNILETSMGIQRFAESPEEVTKGQDVRLGFPELLG
LEETLLDILEGRQMNFEIQAIARSSEQGNPIYIDICIIKNYLDEDSNHYLIIFLEEVTER
MILEQNLVQSSNEKSLLLSALTASKAYIETIIVSIAEALIVTTPSGMIKTINRATQYLFG
YSEEELIGQPLSILTCEDGVLLAATQSPLLFQETLNVVEVICKTKTGEKLAIAFSCSAIQ
TDVEGVQNYIYVGRDVTERQRSQKRLAVQYATTRILSESATPSEAIPKILQAIGENLLWD
LGECWTVEVHNSTPQLRCLDTWVRPSLSISELIEKSRQTILVPTVGLVGHVWDIASGYWS
FDIVEDIHFLRSEQAAIAGLQGAFAVPIQSDGEVLGVITFFSCEKQPRDEFLLQVMVGIG
SQVGQFIKRKQAEAALAESEERYRDLFENATDLIQSCDLKGQFLYVNRAWRETLGYSEAQ
VYRMNLFDILHPDCKASFLESLSLAIGGEKIDQIQAAFISQNGTKISVEGNINCKFVEGK
PVATRAIFRDITQRLQAEQALRYQQAQTERLLLNILPEPIADRLKHDTRTIAEDFAEVSV
MFADIVGFTQIAARLRPIELINLLNQVFSAFDRLSEKHGLEKIKTVGDAYMVVGGLPVRR
ADHAVAIAEMALDMQAAISQFRQETGKEFNIRIGINTGPVVAGVIGIKKFSYDLWGDTVN
IASRMESHGVPGKIHVTAVTYERLQEQYLFEKRGVIPVKGKGEMTTYFLKGRKSTFSEDA
L
Download sequence
Identical sequences K9WBQ7
WP_015181805.1.75295 gi|428310082|ref|YP_007121059.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]