SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015182139.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015182139.1.75295
Domain Number 1 Region: 524-846
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.92e-108
Family WD40-repeat 0.00000193
Further Details:      
 
Domain Number 2 Region: 813-1110
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.1e-100
Family WD40-repeat 0.00000207
Further Details:      
 
Domain Number 3 Region: 69-337
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.38e-32
Family Extended AAA-ATPase domain 0.081
Further Details:      
 
Domain Number 4 Region: 483-522
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.0000222
Family Pentapeptide repeats 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015182139.1.75295
Sequence length 1142
Comment WD40 repeat-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MDAVAILTLIGLVIGIIAGVVQVLDFLEKQREKKRSLANQTPSPQIAQVPSAPPEVGRTP
KSIASSHQDWGEAVDTSAFYGRTEELAKLAQWIVRDRCRLVALLGMGGIGKTSVSIKLAQ
QIQDEFKFVIWRSLRNAPPVEDILKDLIKVLSNQQETQLPDTLNELVARLIDYLRQSRCL
LVLDNAESILQGGNRAGEYQQGYEGYGELFRRIGGTVHQSCLVLTSRENPKDIASAAGDA
LPVRYMQLIGLKLTEGEELFHALKVSGSEAQEQELIDFYKGSPLALKIVSTTIQELFDGD
IAQFLQSKVVVFSDIRDLLDQQFNRLSDLEREVMYWLAINREAVSLSELREDIVSLESPP
KLMEAIQSLVRRSLIEKCTALFTLQPVVMEYLTDRLIEQVCDEIKTGKIEVFNRYTLIKA
TAKDYIRETQVRLILKPIAERIPVGAHGCAPLQQMLSKLREQFSRKPGYAGGNILNLLCY
LQTDLNGLDFSNLRIWQAYLQGMTLQHVNFAHSNLSKSVFTQAFDRIVSVAFSPDGKLLA
TGDVVGQVRIWQVVDGQQLLTFQGHSNWVSSIAFSPDGQLLAVTGHSDSTIQLWEASTGK
CVQILPGHTGWVSSVAFSQDGQTLASGSSDLTVRLWSFSTGQCLRILQGHTDRVWSVAFS
RDGQTLVSGSNDQTVRLWEVSTGQCLRILQGHTDQVRSVVFSPNGQTVASGSADQTVKLW
EVSTGHCLKTLEENTNGTRTIAFSPDGRILASGNYDQTVKLWEVSTGQCLRILQGHTDRV
WSVAFSPDGRILASGSDDQTVRLWEVNTGQGLRILQGHANKIGSVAFSCDNQWLATGSGD
KAVRLWVANTGQCSKTLQGHHKAVTSVAFSPNSQTLASSGDNTVRLWDVTTGHCLHVLQG
HGSWWVQCVAFSPDGQTLASGSGDQTVRLWEVTTGQGLRVLQGHDSEVRCVAFSPDSQLL
ASGSRDGMVRLWKVSTGQCLNTLQGHNDWVQSVAFSQDGQTLASSSNDQTVRLWEVSTGQ
CLKTLQRQTRWGESPAFSPDGQLFAGGSNDATVGLWEVSTGKCLQTLRGHTDKIWSVAFS
RDGQTLISGSQDETVKIWNVKTGECLKTLRAARPYEGMNITGVTGLTEAQKTMLKTLGAV
ES
Download sequence
Identical sequences K9WEN6
gi|428310416|ref|YP_007121393.1| WP_015182139.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]