SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015182537.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015182537.1.75295
Domain Number 1 Region: 69-238,267-296
Classification Level Classification E-value
Superfamily TPR-like 2.06e-20
Family Tetratricopeptide repeat (TPR) 0.0048
Further Details:      
 
Domain Number 2 Region: 326-451
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000721
Family Tetratricopeptide repeat (TPR) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015182537.1.75295
Sequence length 870
Comment hypothetical protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MGLSYPGTLPKKFQMWQHWHRFSLLFLASLVFCCVFHFGSLRQVAHSATPQRQFTASIPS
QEPYSQVVQQGVERYQAGKFTEAIALWQKVLSQITSPKERAALYSNLALAYRQIGQSGKA
IAHWQQAIQIYQHQDDQAARSQLPKLLTEQAQAYNELGQNRQAIKILQSALERAKQIPDL
QTQAATLGALANAYWAVGNYEKALFSHQASLKIARQLNTPDYIASSLNNLGNLYISRSER
YRYQANVARVEGDEPEKIRLMQLAEQEMTAAQSAFNESLRETQAVGGITYVKTLLNLNRL
LEQLPSPDWAAIARNREKLLVRVETLPDSRDKAYILINLAQHFSDPEPGRNALDASLVLK
KAVSIARNIGDQRAESFALGSLGQIYKSAGQTSEAMELTQQAQWVAMQANAPDSAYRWQW
QTGRLLKAGGKTKEAIASYEQAIATLQSIRNNLLAINTNLQFDFRDSVEPVYRELMQLLL
EPSMLRNLEQRKTNLSKVIDTLELLKLAELQNYFGDECVEVAQADAKSEASLLDANSAII
YSVILHDRTEMILRLPDGLLTSYSVSLNQEQMQQEIDQLRKLLEKRSTNEYLLAAQKIYN
ALIRPLEADLAAAKVKTLIFIQDAMLRQVPMAALHNGQQFLIENYAIATTPSLALTTRTR
APEHYSSALIMGLTVERPPFIALTNVRTEVASVQKLLGGTQLLDQDFTLANLQEQLQNKS
YPVVHIATHGKFGVDAASTFLLTFDSRMTLEQFDEVLREAKLSQKRSQRNQQPVELLTLS
ACQTAAGDNRAALGIAGVAVRAGVRSALASLWNINDEATVPLIEEFYTQLEQPYVTKAKA
LQTAQLKMINHLEYSHPAVWSPFILIGNWL
Download sequence
Identical sequences K9WDS6
WP_015182537.1.75295 gi|428310817|ref|YP_007121794.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]