SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015182642.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015182642.1.75295
Domain Number 1 Region: 305-485
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.44e-35
Family Histidine kinase 0.0000136
Further Details:      
 
Domain Number 2 Region: 661-779
Classification Level Classification E-value
Superfamily CheY-like 1.71e-31
Family CheY-related 0.0016
Further Details:      
 
Domain Number 3 Region: 4-115
Classification Level Classification E-value
Superfamily Histidine-containing phosphotransfer domain, HPT domain 3.14e-23
Family Chemotaxis protein CheA P1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 488-638
Classification Level Classification E-value
Superfamily CheW-like 3.79e-21
Family CheW-like 0.00069
Further Details:      
 
Weak hits

Sequence:  WP_015182642.1.75295
Domain Number - Region: 186-226
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00188
Family Homodimeric domain of signal transducing histidine kinase 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015182642.1.75295
Sequence length 779
Comment chemotaxis protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MMIDDEELRNLYKVASADHIQKIETGLLHLEKNPQDGTQLEQLLREMHSLKGDSRMLGVT
DVETLTHQMEDILGGVKRSERVLTPPVFECLYQGLDAVRQIATEAVTGQAAGVSVFHVLA
LLMGAASEDASEDALTLMAETVGEVQGEASSQPHERPVVFNDSVQTQEPILPAADTLAQV
SDYQIDTIRVAAQKLDKLLTQASELAVTKGQISDRLSDIDQLMTLWEEWNREAFVSRLTY
DELERRLQTPELQPLQNFYNLVEARLEQLGTLLNRLRNITFEDNAKLETVASELESGIHA
LRLLPFSTIFNLFPRTVRDLAKQQGKDVNLVLEGGDISVDKRILEEMKDPLLHLLRNAID
HGIETPQERQSLGKPAIATIRLRGYQVGSTVSIEIIDDGRGLDVPAIKQAAMSRGIRSPQ
ELAAMSTAEVQALIFAPGFSTRTAVTEISGRGVGLDVVRANVERLKGSIQVEFTPGRGCL
FRIMLNSSLATTDALIVQVSEHPYAIPVGYVEAMQLVSPQEIFAHASEAVATLEVSGCQT
LPFQGESVSVVWLADLLGLPVKAPASTKALRAATKTIPCIILRIGSERLAVLVDTILEQQ
DIVLKPQSQLLKRIRNISGATILGTGDVCMVLHPPDLFKSAKKAIVSVTVKELTEQAQVK
QKILLVEDSIPIRTQMKRILESAGYDVTAAVDGEDGFKKLKTGMFKAVVSDVQMPHLDGL
GLTTRIRQFREYQDLPVILVTTLASEEDKHQGKQAGANAYITKGDFEQGILLDTLRRLI
Download sequence
Identical sequences K9WE36
gi|428310922|ref|YP_007121899.1| WP_015182642.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]