SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015182725.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015182725.1.75295
Domain Number 1 Region: 44-173
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.41e-26
Family Heme-binding PAS domain 0.053
Further Details:      
 
Domain Number 2 Region: 485-559
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.49e-25
Family Histidine kinase 0.0064
Further Details:      
 
Domain Number 3 Region: 283-382
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.000000000586
Family Histidine kinase 0.025
Further Details:      
 
Weak hits

Sequence:  WP_015182725.1.75295
Domain Number - Region: 214-253
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000785
Family Homodimeric domain of signal transducing histidine kinase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015182725.1.75295
Sequence length 561
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MFLSRDNLSASSANRVEYYEKVHNNLVERTKQLKRANHELAHQIAERQRVEEALRQAEQK
YRSIFENAVEGIFQTTPEGYYLACNPALARIYGYESADALLKNLTNIGQQLYTDPNRRQE
FIEQLYTCDVVSDFESQVYRKDGSIIWISENARAVRAEDGTLLYYEGFVTDITQRKLAEE
ASQRAEAQLRAKAEQLKQTLTKLQQTQAQLIHNEKMCNLGQLVAGVAHEINNPVNFVCGN
LIPATQYVDDLLDLLRLYVKHYPQPEPEIQARAEAIDLEFLVEDFPKTLSSMQLGADRIR
QIVQSLRSFSRIDESQMTQVDIHKGIDSTLLIINNRLKPKGDNPGIAVVKEYGELPPIKG
YAGLLNQVFMNLLCNAVDALEDCPPTLCAQTDTDVEEHYKPIKGNSSSNNQAYSLKNCSG
TPMWRHGCIGVSDRETRASASSPTPASACTQETDIVSMFSPRESPKVIRICTELLESDAR
DGKVTEPRVVIRIIDNGSGMQEEVRSQIFHPFFTTKPVGKGTGLGLSISYQIVVEKHGGQ
LQCISVPNQGTEFRIEIPIQL
Download sequence
Identical sequences K9WFM7
gi|428311005|ref|YP_007121982.1| WP_015182725.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]