SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015182764.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015182764.1.75295
Domain Number 1 Region: 33-173
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000000393
Family GAF domain 0.017
Further Details:      
 
Domain Number 2 Region: 357-522
Classification Level Classification E-value
Superfamily GAF domain-like 0.0000000000807
Family GAF domain 0.013
Further Details:      
 
Domain Number 3 Region: 206-345
Classification Level Classification E-value
Superfamily GAF domain-like 0.00000000017
Family GAF domain 0.0079
Further Details:      
 
Weak hits

Sequence:  WP_015182764.1.75295
Domain Number - Region: 563-692
Classification Level Classification E-value
Superfamily GAF domain-like 0.0013
Family GAF domain 0.021
Further Details:      
 
Domain Number - Region: 806-880
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.0165
Family Histidine kinase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015182764.1.75295
Sequence length 966
Comment hypothetical protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MSQQNQQPHNDDQLVALGRVLQTLREEENADVLIETTLDYLTHEFNYGLIWIGLYDRLEH
RLFGKGGVTPNGETLFLRQWFNLNPGDLLEQVVIQQRPVGVPDLRQEIRAGEWRRAAQEF
NIQGTLLFPLRCKDRCFGVVLLGSHLWGVSPQPDEKAQLSLLLGGLAAALYQIEVDWQRS
SIKRPEQAVFQVLDELMQVSTVVPRLEALIKMTQQFITPTRTNLYWYSPEQRYFWQRVGN
RERIPRLGSSRTNAPGLTVAEVHDFYQALAAGQLVTIGAGRSLLKSDITERLLGRLRARS
LLAAPIQAQGELLGFLSVEDSEARIWEEAELKYVRAAAQLVTLVVGTEELETTLQETQNN
AQFAAEIAQAIARSLDLNTALKECAKLLCTRLDADRFLVLQEEERGEFTLVFGTQPLNRR
PLASPFAAVSPEDRQWLFNNAEAVFIEDLDLDWRLRPWREAFQLVGVRSLLICQTSKSSH
YNSLNPAKGSPLLVIADRKPRTWNPTQRSLVSIVAQQLNLLLLLGNYTESAKKSLLAQET
LQVGLSTLFQAPQDPIQLERIGLNYLANLLECPLAALITWIPGSEWGTIAATVVADPAFA
LPPDLAIPITSDRLIQDTLAARHFLCCSVTELTAFTRNWLNSPAIGQLLAIPLHADATPT
TGIVLFADQEERQWPTHLLSALEILTQQFTWLRHYQYTLTQYTQGVEDLQTLNWYKHRCL
DMLQQSVRESVSALLELDAQRLPPPSTEEGQDAQPQEAGQGHAQGAMPGSASLQQMRRKQ
LLHQMEQALALLRPVLQDEQWQLTVKPRAIPLANLLKRSLRRVEPLYKQHQLGLQVYNSA
NKSIYGDRLKLECILFELLVTFCIHAQPGSRINLWCSPFSTQFKTTLISPTSRPFQELLI
AESGVLDECLQAVTSSAPLPPPSLNLKICQRVLQVWGGDLQFYPLAFRVASEEYRYSTRL
LIPLAK
Download sequence
Identical sequences K9WE17
WP_015182764.1.75295 gi|428311044|ref|YP_007122021.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]