SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015183574.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015183574.1.75295
Domain Number 1 Region: 627-717,769-839
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.24e-33
Family Histidine kinase 0.0012
Further Details:      
 
Domain Number 2 Region: 270-368
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 5.06e-29
Family Flavin-binding PAS domain 0.041
Further Details:      
 
Domain Number 3 Region: 140-252
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.42e-27
Family Heme-binding PAS domain 0.048
Further Details:      
 
Domain Number 4 Region: 554-636
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.73e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0022
Further Details:      
 
Domain Number 5 Region: 402-548
Classification Level Classification E-value
Superfamily GAF domain-like 6.54e-16
Family GAF domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015183574.1.75295
Sequence length 846
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MREAKRLLLSSYGVPVLASLLALLLRSLLAPLLRENAPLLVFIIPVMISAWYGGLKPGLL
ATAISALIGCYFFVQPVFSLDITGVANGVRIGIFLVEGVLISWLSETRRGAMQRSEAIAS
SLRESEESYRLLVEGVEDYAIFRLDPKGNIVTWNNGAERIKGYKAADILGQNYSILFTVE
DIERHKPEQALLMAVREGHFVEDSWRRRKDGSLFWASTTITALRNESGKLCGFSNVIRDI
TQRKQAEEELRKLVKDLSDVKFAIDRAAILATTDERGNITNVNDKFCELSQYSREELIGQ
NHRLINSGYHPQEFFANLWSTIKRGDVWHGEIKNRAKDGSYYWVDTTIVPFLDDAGQPFQ
YLAIRFDISDRKHAQEVLHRYAQRLEALHEIDRAILRAESTKQLARAALLRLHSVVPYEQ
AMVVLFRFQTQEAELLTREWNGELRRETIPISDLIPIQVSLQQVSIRYIENLSTLAPCPP
LLERQLAEGKRSFLSISLIAEGELIGELGVFARPVAAFTQEHQEIVTEVANQLAIATQQA
RLREQRQNYAAELEQRVIERTAELQEANEALEVFVYSASHDLRAPLRGIQGLAQVLLEDY
GDLFDSEGQLYAQRLVLSAQEMSALLQDLLDYSRLSRAEINLQRIDLASIMTSALTQLQT
ELQAQKAQVRVEIPCFEVMGHRATLIQVVTNLITNAIKFVPPGVQPQVRIWAEERGVGDE
EHQNVSADENMTQLQPRDENKTLLPDIRTPSRYAIPNNQVTPVAAVSANIRLWIEDNGIG
IEPRHQENIFQAFERLHGVETYSGTGMGLAIVRKGVERMGGRVGVESQFGDGSRFWIELR
QTTSTA
Download sequence
Identical sequences K9WGV2
WP_015183574.1.75295 gi|428311862|ref|YP_007122839.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]