SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015183984.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015183984.1.75295
Domain Number 1 Region: 742-914
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.03e-46
Family Histidine kinase 0.0002
Further Details:      
 
Domain Number 2 Region: 5-190
Classification Level Classification E-value
Superfamily CheY-like 8.68e-29
Family CheY-related 0.002
Further Details:      
 
Domain Number 3 Region: 172-286
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.39e-26
Family Flavin-binding PAS domain 0.076
Further Details:      
 
Domain Number 4 Region: 480-660
Classification Level Classification E-value
Superfamily GAF domain-like 2.4e-22
Family GAF domain 0.012
Further Details:      
 
Domain Number 5 Region: 672-754
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.51e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0012
Further Details:      
 
Domain Number 6 Region: 305-465
Classification Level Classification E-value
Superfamily GAF domain-like 1.07e-17
Family GAF domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015183984.1.75295
Sequence length 952
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MEEIIKILVVEDDEVDRMAVSRALKRAGMSVEITASVDCHSALAALLQGSIGEDGNDTTQ
ETHPANATLKEPNFDCVLLDYRLPDGDGLGLVQQVRGIGIKVPLVVLTGQGDEQLAVELM
KAGASDYLAKSKLSPETLSRSVRNAVRIYRAEKQAASADERLRESEERYRLVLEGSNDGI
WDWDLITHAIYCNDRLYEIMGLSADEVVINYDLVCQLIHPEDRLRISQAVAAHLQDNVEL
DVEFRLLHSSGEYRYCMARGKAWRDAQGKPFRMSGVISDITERKRAEESLRFLAEASAML
SASLDYEKTLASLARLAVPFLADLCVVDIVENGVVRRMGVAHADPTRDEQVRKLHHLYPP
DLNGTHPAIKVIQTGIAVLVPEMADQEWIGATYNAEHLQIVQDMSFKSYMTVPLLVRGRT
LGAISLVSTQQSRRYKPADLALAEELARRAALSLENGQLYRETQETSENLRQAILILGEQ
QQQLRTLQQLTNLLNQRLTNLPGLLREMAEAVAGAIPGAQFCCIMLNNPQCDGLVLTVMA
GIETEKLRLENAFSPQGGLLYQVFSTGESQLIQNREGESASLQKHPAAMYAVAIESVQSG
RLGVLTIGNWQDHNAFDEEDRNLLVAVGEQAAIAIDNARMIKALEEQEKRLEDQNEMLAH
KNQELEHQRQQLQLNNLQLLEAARLKSQFLATMSHELRTPMNSVIGFSQLLLRQRHNPLT
SQQTDMMKRILDNGKHLLALIDEILDLSKIDTGRLQLKLETFNLMTLVKATVEELRSLAD
ERNLMLHVHDQLKNANVINDSVRLRQILVNLLSNGIKFTETGSVEVEVKEIAPNRLVIAV
KDTGIGIAEEELGHIFEEFRQIDQTTTRRYPGTGLGLAITKSLVELMQGTIEVESQLGQG
STFRIELPRTVKPSTSNLPRTGHKLTQLGASSLSHGSLTQSLKKPTAGRILY
Download sequence
Identical sequences K9WI27
WP_015183984.1.75295 gi|428312277|ref|YP_007123254.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]