SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015183986.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015183986.1.75295
Domain Number 1 Region: 698-848
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.67e-34
Family Histidine kinase 0.0022
Further Details:      
 
Domain Number 2 Region: 374-485
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-23
Family Heme-binding PAS domain 0.039
Further Details:      
 
Domain Number 3 Region: 251-362
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-19
Family Heme-binding PAS domain 0.0041
Further Details:      
 
Domain Number 4 Region: 614-697
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.65e-16
Family Homodimeric domain of signal transducing histidine kinase 0.0035
Further Details:      
 
Domain Number 5 Region: 473-595
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000436
Family Flavin-binding PAS domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015183986.1.75295
Sequence length 851
Comment PAS domain-containing protein [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MDASKFSSTRLKFPSDVWVRRRGAFIISIPVICLLASILVIAALRARTIAVRQQEQQSQK
TVTDTSRLLKELIEAETGVRGYVITRRPEFLSPYLKAKALLPQSVDTLYAQVENYPARRQ
QFQEILSLARQQFQLLEQTLETSDRQGATAGTSTLITERLQESRLNMDELRQAISEFYEQ
EKRWQNDRQVQAFRWARVTTIVQWTCLAVGLLGSGAALCLFNQLDQDRRQQASRLRTNNL
YLQAIFDHVVDGIIIVNSRGYIQSANSATGEIFGYEPSELQGVHLQRLMAELFAEDSGQA
MKSLVGKNHDKLRLQQETVGRQKSGQIFPMEFALSEMQLDNEHLFIVIVRDITERKQSQD
ILLKQAQLLNLANDTIIVRDLNDTITYWNQGAQRLYGFSPAEAVGQCIHSLLQTEVPQPL
EEIEEALFQQGYWSGELMHSRRDGSRVFVKSGWTLQRDETGMPLAFLEINQDITERKQAE
AALRKSEELYRTLVKNFPNGAVFLFDQQMRYSIAEGTGLANINLNSELLTGKTIWETLPL
ETAQILEPIYREALQGKRTVTEIPFSDRFYCVHVLPVINEDGEILLGMTMTQDITESKKA
QQALRARADELARLTTVLAQTTTNLEKRNAELDQFAYIVSHDLKAPLRAIANLAQWLEED
LADSLTAETRHQMDLLQGRVHRMEALINGLLQYSRVGRFRTELELVDMEILLAEVIDSLA
PPPEFTITVMPDMPTLWIERVPLEQVFANLIGNGIKHHHRKDGKIVISAQEHTDCYEFAI
ADNGPGIAPEFHEKVFIMFQTLEPRDKVESTGVGLAIVKKIIEDKGGTIVLESAPSQGAT
FRFTWPKQPMA
Download sequence
Identical sequences K9WHF7
gi|428312279|ref|YP_007123256.1| WP_015183986.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]