SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015184294.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015184294.1.75295
Domain Number 1 Region: 262-425
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.62e-36
Family Histidine kinase 0.0046
Further Details:      
 
Domain Number 2 Region: 11-155
Classification Level Classification E-value
Superfamily CheY-like 7.4e-35
Family CheY-related 0.0012
Further Details:      
 
Domain Number 3 Region: 155-196,226-256
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000392
Family Homodimeric domain of signal transducing histidine kinase 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015184294.1.75295
Sequence length 426
Comment hybrid sensor histidine kinase/response regulator [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MTFDVEPSDVTPAKILIVDDELELERLIKQRLRKKIIAKEIELIFVHNGKEALDKLKSGH
QIDMVLTDINMPEMDGLTLLNKLREIDETLKAVVISAYGDMKNIRTAMNCGAFDFITKPI
NFEDLAITINKTLKDVKEVRETMKQLQQAQLQLLQQEKMAVLGQLVAGVAHEMNNPLTCI
AGYTELSSEGVRNLINHIRLYQEQFTEPGLEIEQHAKNIKLDYFLERLPRMLSVMTESTS
RLVHISNSLRTFSRGDIDSQVSTNIHEGIDSTLMILQHRLKGNNTRPEIQVIKDYGEIPL
VKCYLGQLNQVFMNILANAIDACEDLNESRSLADITEQPNTITIQTQLSENHQSVVIKIK
DNGTGMTEDVESRIFDQLFTTKPVGQGTGLGLSISRQIVEETHGGSLTCYSVLGEGTEFA
ISIPIA
Download sequence
Identical sequences K9WJ02
WP_015184294.1.75295 gi|428312587|ref|YP_007123564.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]