SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015184579.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015184579.1.75295
Domain Number 1 Region: 237-420
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 1.27e-42
Family Histidine kinase 0.0056
Further Details:      
 
Domain Number 2 Region: 444-571
Classification Level Classification E-value
Superfamily CheY-like 5.12e-38
Family CheY-related 0.0052
Further Details:      
 
Domain Number 3 Region: 1-176
Classification Level Classification E-value
Superfamily CheY-like 9.39e-25
Family CheY-related 0.0065
Further Details:      
 
Domain Number 4 Region: 167-249
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 7.26e-23
Family Homodimeric domain of signal transducing histidine kinase 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015184579.1.75295
Sequence length 653
Comment hybrid sensor histidine kinase/response regulator [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MSKGTIICVDDERVVLISLRDQLTHHLGNEYEIELAESGDEALEIFAELQEEEIEIPLII
SDQIMPGMKGDELLSNIRIQYPKTLKILLTGQASAEALGNAVNSANLYRYIAKPWDETDL
CLTVTEAIRSYFQDKQLAEQYRALQRANDELEELNASLEQKIAERTLEFQQAKEAAEHAN
RAKSEFLSKMSHELRTPLNAILGFTQVITRDKALNPVHQEHLAVIKRSGEHLLSLINDVL
EMSKIEAGRITLNENTFDLLRLLSSLEEMLQLKAKSKGLQLIFHYAPDLPQYVQSDESKL
RQVLINLIGNAIKFTSSGGVALRVGRRQKLEVKIQNRESLPKSFFLYFEVEDTGPGIAAD
DLDSLFDPFVQTKTGKISQEGTGLGLPISKQFVQLMGGTITVSSTLGAGTTFKFDVKVRP
AEAASIQTGESRQRAIALAPNQPTYRLLAVDDRWESRKLLVHLLSPLGFQVREAENGQEA
VALWESWQPHLILMDMQMPVMDGYEATQQIKAHLKGQATTIIALTASAFEADRTMILSAG
CDDFLRKPFREEVLLEKIATYLGVRYLYEDSSQPTSQKPEEKVEVLTPEALVVMPTQWQQ
ALYWAAKACNDDELLTLIEQIPARHAALKSALADLVNNFSLDVIIDLTQISIS
Download sequence
Identical sequences K9WKY3
gi|428312873|ref|YP_007123850.1| WP_015184579.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]