SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015184679.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015184679.1.75295
Domain Number 1 Region: 370-709
Classification Level Classification E-value
Superfamily TPR-like 6.07e-77
Family Tetratricopeptide repeat (TPR) 0.0011
Further Details:      
 
Domain Number 2 Region: 9-113,148-307
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.32e-49
Family Protein kinases, catalytic subunit 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015184679.1.75295
Sequence length 738
Comment serine/threonine protein kinase [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MNLGLGQTIGGRYTIISQLGQGGFGRTFVAQDQHLPDHQQCVVKQLKPQATDPFTLQTAR
RLFDTEAKVLHRLGSHDQIPQLFAYFEENQEFYLVQEFIEGDDLSQELTPPTPPYQGGAN
TGNPSLYQGKASAGNLPLYQRGARGGQLSEDKVISLLKEILEILDFVHQQNVIHRDINPR
NIIRRKQDGKLVLIDFGAVKQVSTQVVQGGRTNITIAIGTPGYLPSEQANSNPKLSSDIY
AVGMVGIQALAGISPEQLPINPDTGEISWQDKASVSLEFAEVLDKMVRYDFRQRYQSAAL
ALQALNELKTISKSTVSLPAAASSKPIIAKPKLSKSLLYKVLISMGVLSLGLAATVLIVN
LVKSSNATDLYKRGDTFLELKRYDDALASYNRAVELKPEYAAAWNGKGNTLLALKRYEEA
RNAYDKAIQIQPDYAEAWIGRGNALDSLQQYKEAINSFDRALEFKSDSLEAWNNKGNVQI
KLQKYSDAIASFDKAIELQPNYAPTWNHRGWALHNLRQYEEAVKSYNKAVEYQPDFPNAW
YQRGNALINLQKYQEAVESYDKAVQFQPNFYKAWYSRGSALLNLRQYEQAFASFDQAVKF
NPDDSEAWYNRGWSLHQLQRYQEAVASYNKAIQLRKKFYQAQYNLGNVFYKLKRYQDAFV
SYNKVLEIQPNHYEAWYSRGNALVNLKRYQDAIDSYNKALQYKPDYQAAKDARNQAESQL
DSVPKKPEEQKQQGEAKN
Download sequence
Identical sequences K9WL86
WP_015184679.1.75295 gi|428312973|ref|YP_007123950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]