SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015185152.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015185152.1.75295
Domain Number 1 Region: 457-548,597-673
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 8.04e-40
Family Histidine kinase 0.0034
Further Details:      
 
Domain Number 2 Region: 385-469
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.47e-20
Family Homodimeric domain of signal transducing histidine kinase 0.0015
Further Details:      
 
Weak hits

Sequence:  WP_015185152.1.75295
Domain Number - Region: 334-383
Classification Level Classification E-value
Superfamily HAMP domain-like 0.0968
Family HAMP domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015185152.1.75295
Sequence length 708
Comment two-component sensor histidine kinase [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MAKPGQSSFRRILLSRLLLLSVPVLLLGVYVTYRKARSTLLETARQNLIESAVRKGQNIQ
QAVDTLKANLEIARESVELQSPSPGADQEFIDQLAQQLPTLIECVQLSDIQTRKLVASTC
GNQAIAQKQPTLWPWQRSLLPRNRSPIYVTALLPQKPSTTVGTNPKRTDSTHQLPLVFSA
PVYNAEGQLRYALSIQSSLVHSQPTKRRSLSGYPVVINQEGTILSHIDPTRIGRSIVQEK
DRGALKEVLSQSLDGQQDSLHLFSFEREGVELVAGYTAIQSPMTAEPNQKWVILSITSIE
SALYGLKDIQQVLLVLTCCLIAASFLATLYVARDLARPLEKLRDYALHESDLHSTDRIPR
NFKIREFNQLSDAFEGMITRLRAWAEELETAWKEAQTANQLKNEFLANTSHELRTPLNGI
IGCLRLVRDGFCDDREEELDFLQRADDAAIHLLGIINDVLDIAKIEAGKLTVETEPLDLR
KILNEVINLQAVPIQQKGLEFHTTDLDKVIPVRADPAKLKQVLLNVVGNAVKFTDSGNIT
INTRIEAFAETSPEVSLNNGNDRGEIAGSKEKKRERLSLPSTGDASTDSTSVTPSSRVVV
TVKDTGIGIDPTQQPKLFRPFVMVDGTTTRKCGGTGLGLAISRNLMSLMGGNITLSSDGD
GHGTKVEISLPIIEHSLLFSGDSQLSNDVAQMFESADNNAEDSNVISQ
Download sequence
Identical sequences K9WMM2
gi|428313448|ref|YP_007124425.1| WP_015185152.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]