SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015185464.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015185464.1.75295
Domain Number 1 Region: 204-361
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.23e-35
Family Histidine kinase 0.00096
Further Details:      
 
Domain Number 2 Region: 3-135
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 4.19e-24
Family cAMP-binding domain 0.0065
Further Details:      
 
Domain Number 3 Region: 144-211
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.000000000216
Family Homodimeric domain of signal transducing histidine kinase 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015185464.1.75295
Sequence length 361
Comment signal transduction histidine kinase [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MELKSHKFISFFEPEQASELCRIAIVEDLPDQTLIFDEGDPADFLYLVLAGQVEFRKRIS
PNHYQTLTKALPNGFFGELGILDGQPRSTQAIACQEATLAKIPGNGLMQILENTKGSVAI
KLFSYMIQRLRDSTDEYVKQVVHKEKMVLLGEMLNTVIHDFKSPLSGINLASGMIQELHS
DEETVEWCYLIQAQAHRMSAMAEEFLEFVRGNSVLNKQPINLAVVLQLFEKLNRVYFHEA
QVEFVIQAADVVVNVDENKLLRVVQNLVGNAVEAFKGCGGRVELTAWVNESGVNIKIRDN
GPGIPEAIKDRLFEAFVTYGKHSGTGLGTAIAKSIIDAHGGQISFESSCQEGTTFYINLP
L
Download sequence
Identical sequences K9WNH9
gi|428313763|ref|YP_007124740.1| WP_015185464.1.75295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]