SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015186036.1.75295 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015186036.1.75295
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ribosomal protein S19 7.98e-35
Family Ribosomal protein S19 0.0000213
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015186036.1.75295
Sequence length 92
Comment 30S ribosomal protein S19 [Microcoleus sp. PCC 7113]; AA=GCF_000317515.1; RF=na; TAX=1173027; STAX=1173027; NAME=Microcoleus sp. PCC 7113; strain=PCC 7113; AL=Complete Genome; RT=Major
Sequence
MGRSLKKGPFVADSLLRKIEVLNSRGEKQVIKTWSRASTVLPQMVGHTIAIHNGRTHVPI
FINEQMVGHKLGEFAPTRTFRGHSKSDRKAGR
Download sequence
Identical sequences K9WNY9
WP_015186036.1.75295 gi|428314337|ref|YP_007125314.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]