SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015187438.1.78850 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015187438.1.78850
Domain Number 1 Region: 3-85
Classification Level Classification E-value
Superfamily Ribosomal protein S19 7.46e-36
Family Ribosomal protein S19 0.0000159
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015187438.1.78850
Sequence length 92
Comment MULTISPECIES: 30S ribosomal protein S19 [Chroococcaceae]; AA=GCF_001904655.1; RF=representative genome; TAX=247279; STAX=329163; NAME=Chroogloeocystis siderophila 5.2 s.c.1; strain=5.2 s.c.1; AL=Contig; RT=Major
Sequence
MGRSLKKGPFVADSLLSKIEKLNAKGEKQVIKTWSRASTILPQMVGHTIAVHNGRQHVPV
FINEQMVGHKLGEFAPTRTFRGHAKSDKKAGR
Download sequence
Identical sequences A0A1U7HUN1 K9XD49
WP_015187438.1.78850 WP_015187438.1.9315 gi|434391775|ref|YP_007126722.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]