SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_015188437.1.9315 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015188437.1.9315
Domain Number 1 Region: 355-540
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 3.25e-61
Family Pyruvate oxidase and decarboxylase PP module 0.000048
Further Details:      
 
Domain Number 2 Region: 1-171
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.37e-54
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000199
Further Details:      
 
Domain Number 3 Region: 180-361
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 2.12e-41
Family Pyruvate oxidase and decarboxylase, middle domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015188437.1.9315
Sequence length 545
Comment acetolactate synthase large subunit [Gloeocapsa sp. PCC 7428]; AA=GCF_000317555.1; RF=na; TAX=1173026; STAX=1173026; NAME=Gloeocapsa sp. PCC 7428; strain=PCC 7428; AL=Complete Genome; RT=Major
Sequence
MNTAELLVQCLENEGVRYVFGLPGEENLHVLEALKNSSIQFITTRHEQGAAFMADVYGRL
TGKAGVCLSTLGPGATNLMTGVADANLDGAPLVAITGQVGTDQMHIEAHQYLDLVAMFAP
VTKWNTQIVRPSNTPEIVRKAFKRSQSEKPGAVHIDLPENIAAMPATGNPLKTDKLERTY
AAFHSITEAATAISNAHNPIILVGNGAIRADASEAVTEFATQLNIPVANTFMGKGVIPYK
HPLALWSVGLQQRDYINCGFDNTDLVIAIGYDLIEYSPKKWNPDGKIPIVHIGETPAEID
SSYIPLVEVVGDISDSLYEILKRADRDDKPDPYALELRADIRADYEQYANDDGFPIKPQK
LIYDLRQVMGPEDIVISDVGAHKMWIARHYHCDRPNTCLISNGFAAMGIAIPGAVAAKLV
YPHRKIVAATGDGGFMMNCQELETALRVGTPFVTLIFNDGGYGLIEWKQRNQFGRSSFVH
FGNPDFVKLAESMGLKGYRVEATTDFIPILKTALAQDVPTVIDCPVDYQENYRFTQRAGE
LNCIV
Download sequence
Identical sequences K9XEQ1
gi|434392777|ref|YP_007127724.1| WP_015188437.1.9315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]