SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015188909.1.9315 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015188909.1.9315
Domain Number 1 Region: 10-256
Classification Level Classification E-value
Superfamily PP2C-like 0.000000000000772
Family PP2C-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015188909.1.9315
Sequence length 263
Comment hypothetical protein [Gloeocapsa sp. PCC 7428]; AA=GCF_000317555.1; RF=na; TAX=1173026; STAX=1173026; NAME=Gloeocapsa sp. PCC 7428; strain=PCC 7428; AL=Complete Genome; RT=Major
Sequence
MSWKAISRSAIGTSHRKQHLPCQDYGSYQVFNKVIVGAVADGGGSAKYADIGAKLAVDTV
IEHFTEFEAYLRKRKHFWQRNIPPITERYATKIFTKAVKKVAAVLKEQAITKGYSVNDLA
CTLLVVIATPTWIAAMQIGDGFIAVRFPDQLQILFPPHKGEYINETTFVTSANALKAMQV
CVYEGKQKFICAATDGLERVAIRMSDGTPFDPFFQPLEEYLQETQNPEAEDEYLKDFLSS
DRLNARTDDDKTLLLCLYDNNSC
Download sequence
Identical sequences K9XHB8
WP_015188909.1.9315 gi|434393250|ref|YP_007128197.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]