SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015201253.1.21814 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015201253.1.21814
Domain Number 1 Region: 28-143
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.000000724
Family Carbon-carbon bond hydrolase 0.09
Further Details:      
 
Weak hits

Sequence:  WP_015201253.1.21814
Domain Number - Region: 186-246
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.093
Family PG130-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015201253.1.21814
Sequence length 256
Comment hypothetical protein [Crinalium epipsammum]; AA=GCF_000317495.1; RF=representative genome; TAX=1173022; STAX=241425; NAME=Crinalium epipsammum PCC 9333; strain=PCC 9333; AL=Complete Genome; RT=Major
Sequence
MEWQEVNGNWVYIPQYHTGIVHFLGGAFVATAPHVTYRLLLEDLASKNYAIIATPFVNTF
DHTAIAKSVHQSFDRTIEQLRAKSLLRRRYLPIYGVGHSMGCKLHLLIGSLFPVERAGNI
LISFNNFAARDAVPLVEQFSGAFTVEFTPSPLETISLISQRYQVKRNLIIKFNNDNLDQS
LALRETLDKRFPGMITSQILKGSHVTPLGQDFKWQVSSVYTPFDALGQWMKQEVYRDLHQ
LKQEMLRWLNPLAINN
Download sequence
Identical sequences K9VU81
gi|428303794|ref|YP_007140619.1| WP_015201253.1.21814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]