SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015227112.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015227112.1.10129
Domain Number 1 Region: 112-281
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 1.53e-57
Family NadC C-terminal domain-like 0.0000147
Further Details:      
 
Domain Number 2 Region: 4-111
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 8.63e-23
Family NadC N-terminal domain-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015227112.1.10129
Sequence length 282
Comment nicotinate-nucleotide diphosphorylase (carboxylating) [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MTLPPNILIEPLLQDWLREDIGRGDRATSALIEPTLIPQEAVWIAKQPGIIAGLPIAEKI
FRLLGEIVWHPQVSEGESCHQQQEILRCRAQPNTLLTGERVALNLVMHLSGIATLTRSYV
DKIADLPTQLVDTRKTTPGLRVLEKYATQLGGAVNHRFGLDDSAMIKENHIQVAGGVKNA
IAQVRSQLPYPLTIEVETTTQAEVEAALTTEVDIIMLDNMSPQLMSEMVQLIRRSGKAIK
IEASGNITLETIREVAETGVDYISTSAPITQAKWLDLSMKLL
Download sequence
Identical sequences K9YFT4
WP_015227112.1.10129 gi|428777667|ref|YP_007169454.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]