SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015227214.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015227214.1.10129
Domain Number 1 Region: 419-596
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.16e-44
Family N-acetylmuramoyl-L-alanine amidase-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_015227214.1.10129
Sequence length 608
Comment cell wall hydrolase/autolysin [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MKNWLTPLLSGFLLTSYISSPPAFAQSKQDLMLVYPPKQHQTTAEKIFLIGTASATVYVN
GQPIEQSAAGHFAPSFPLQMGDNQFTIRSGDEQVTRRITRISPVPTPPSDGGFAPNSLFP
SQPITRQVGETICLEAVGTPQGEVTATVAEQIIPLLPQAKHALPPNYAVLTGNNAPLSQF
TQLYQGCFKSEIAGNLGNPIYTIKFGDQTITASDTENITILTNAHPQASSYHGGVQMTPI
EKTVVEVTAEAGAARTGPGTSYSRLTPLPKGTRATVTGREGKWLRLGYGAWIDGEATRVI
PDAVSPQTFIRSIKAEPTPQSTEIHFPLQVPVPVRVQQEEDTFTLTLHHTIAQTDTIHLD
DDPLIERLDWQQIDPETVQYTFHLKSDQQWGYNLRYEGPNLILSLKHPPTARSAQPLAGM
RILVDPGHGGEELGAKGPTGYPEKAVNLKVSQLLQAELEQRGATVYMTRETDKFVSLADR
IAMINDLNPAIALSIHYNALPDDGDAINTSGIGAFWYNPPAHDLAVFLHNYLVEELNRDS
YGVFWNTLALTRPHTTLAVLLELGFMINPTEFEWVMNPAAQEKLAGTIADGVEVWWKQKK
ASAETTQR
Download sequence
Identical sequences K9YFR7
gi|428777769|ref|YP_007169556.1| WP_015227214.1.10129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]