SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015227417.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015227417.1.10129
Domain Number 1 Region: 53-353
Classification Level Classification E-value
Superfamily Pectin lyase-like 3.45e-38
Family Filamentous hemagglutinin FhaB, secretion domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_015227417.1.10129
Sequence length 1569
Comment filamentous hemagglutinin family outer membrane protein [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MRAFPSKIDLVLRQTSLSLLLLIIAPFFGIVSTKDAKAQRIIPAEDGTGTEIQDPIATPD
GRQQINIDGGTVSGENLFHSFEQFGLDASEIANFLSDPAIANILSRVTSGDPSIINGLLR
VSGGNSNLFLMNPAGIIFGPNAQLDLTGSFAATTATGIEFENGIFGAVGANEYSALIGNP
TAFRFEQDLASPIINAGDLAVIEGETLSLTGGSVVNTGSLTAPGGNISIAVVPGESRVRI
TQEGRILSLEVPIPQGGNGEPIAIQPLDLPQLLTVGEGIETGLNINDGSVETESGVVIPQ
DESAIVPGELNATSGQANLLADSNLFINTEVIIDGDLTLNSQENVLIGANIISQADNETT
LEVQANRNISVFGDAIESQSSPFNVILNSDRDGNNSGGIVINPGSQINSNGGEIVLGGGT
TPRETPAVGSEELINGVQMQGTLKSGGGDITIRGTGFAGADNQESSPIGVDIQNGDPENP
AQILAEGGNLTVMGRGGEGIGSNLRGVNIEEGSVISSIDDGTIIIEGTGGNGSDGNTGLF
LGNASEITTENGDIELLGQGSLSATSSDNRGLNIQGESQITASGIGNVILEGTGGNGINN
NIGIFLDNATIQTETGDIQGIGKGGLEATGNGNDGIFIFQESQLISSEGEVRLEARGGTN
NSDSIEVISALFDAPLTLQTANGAINGTIEGENEITLNALDEEGIIELSADISTSSGAIT
INDAIVLSDDQTLTGDGITFKETVDSDSLESPRSLTLDTTDNGSTTFEESVGGEIPLNNL
ETNADGQTNLNGGEVNTTNNQIYNDPVILGADTTLNGNNITLNDTVDSNENTQQDLTVES
SGTTTFGDRVGSKTPLDQLVTDANGETNLNGREVNTINNQTYNDPVTLGENTSIKGSNIT
FDADIDTNDEGIGLRIDAEQSLITEKIETNGGDVSLNADTEILTGAIVTNGGNVRLANTE
TISDARQETPRNPEDNNDIEVTYIDTEGGDVTVITERFFRVTETIDGNVSISSVGGGSVT
INHGGDTNNPFIVGEPDLNNGTVGDITNLDFTIEEGVFPFTELEGNIGLISTRESDPDIT
NPDITNPETNPKSNIDGETAVNSDPTQLTPVSLTASRTILSNIEKESGVKAAVIYVRFTS
VVEPIGNGETLESEPSGSLAAELAANSQTNTVPEEEASSLFEELEAESLTPYANYYPGIK
ASPSVVSAPQSTDQMEIVIVTADNEVTRTIVPNIKREAFKEVGLKLREEVLLNQYPGIVR
LQKMRNKTHLEPAQILYNWMIKPVENQLEAQEIENLVFVLPSEFRLIPLATLHDGEQYLV
QKGYSVGLAPALSMINGQYKKVQQAELLAMGTSEFPEIEGAILENELPAVPIELEEVVDD
WGGVKFEGDQFSINQFNAVRRRNPYGIIHLATHANFTEFSPGSSYIRFYDDVLKLDQINQ
LNLKDVELLTLSACRTVFGDQNSELGFAGLAYRAGVKSVLGSLWQIDDAGTLAFMTQFYD
QLDDENVAIKAEAVRQTQVQMIEGRIRIEGQQIITETEMINLPPESAPVQIDLSHPYFWS
GFTIVGSPW
Download sequence
Identical sequences K9YGL9
WP_015227417.1.10129 gi|428777972|ref|YP_007169759.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]