SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015227731.1.10129 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015227731.1.10129
Domain Number 1 Region: 7-203
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 4.07e-66
Family Branched-chain alpha-keto acid dehydrogenase Pyr module 0.00000676
Further Details:      
 
Domain Number 2 Region: 187-323
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 6.54e-40
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015227731.1.10129
Sequence length 327
Comment transketolase [Halothece sp. PCC 7418]; AA=GCF_000317635.1; RF=na; TAX=65093; STAX=65093; NAME=Halothece sp. PCC 7418; strain=PCC 7418; AL=Complete Genome; RT=Major
Sequence
MAQTIFFNALREATNEEMARDDTVFVLGEDVGHYGGSYKVTKDLYKKYGELRLLDTPIAE
NSFTGMAVGAAMTGLRPIVEGMNMGFLLLAFNQIANNAGMLRYTSGGNFKIPLVIRGPGG
VGRQLGAEHSQRLEAYFQAVPGLKIVACSTAYNAKGLLKSAIRDDNPVLFFEHVLLYNLK
EDLPEGEYWLPLDKAEMVRQGKDVTILTYSRMRHHALQAVKPLEEKGFDPEIIDLISLKP
LDMEAVAESVRKTHRVIIVEECMRTGGIGAELTARINDELFDELDAPVVRLSSQDIPTPY
NGTLERYTIVQPQDIIAAVEDMVALKV
Download sequence
Identical sequences K9YHJ5
WP_015227731.1.10129 gi|428778287|ref|YP_007170074.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]