SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_015324664.1.68990 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_015324664.1.68990
Domain Number 1 Region: 16-200
Classification Level Classification E-value
Superfamily FMN-dependent nitroreductase-like 2.09e-45
Family NADH oxidase/flavin reductase 0.0000175
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_015324664.1.68990
Sequence length 201
Comment nitroreductase [Methanomethylovorans hollandica]; AA=GCF_000328665.1; RF=representative genome; TAX=867904; STAX=101192; NAME=Methanomethylovorans hollandica DSM 15978; strain=DSM 15978; AL=Complete Genome; RT=Major
Sequence
MTISTEIDVHQYRKPEINIDELFVRRWSPRAMSGQSVPDKDLMRLFEAARWAPSASNEQP
WRFIYAKKGTKYWDVFFDLVAEGNKRWCKNAAVLMVIISKIRFTKYDAENRTHSFSAGSA
FENLQLQATNLGLVVHPFAGFDENKAAEALGIPEEYYVDVMVAIGMPGKIGNLEEKDRIR
EFPSDRMKLNELIFEGKFDEK
Download sequence
Identical sequences L0KZH2
gi|435851442|ref|YP_007313028.1| WP_015324664.1.68990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]